ADM (adrenomedullin)

Gene

• Entrez ID: 133
• Gene name: Adrenomedullin
• Gene symbol: ADM
• Synonyms (NCBI Gene): AM, PAMP
• Chromosome: 11
• Chromosome location: 11p15.4
• Summary: The protein encoded by this gene is a preprohormone which is cleaved to form two biologically active peptides, adrenomedullin and proadrenomedullin N-terminal 20 peptide. Adrenomedullin is a 52 aa peptide with several functions, including vasodilation, re

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT029565	hsa-miR-26b-5p	Sequencing	20371350
MIRT050138	hsa-miR-26a-5p	CLASH	23622248
MIRT045894	hsa-miR-125b-5p	CLASH	23622248
MIRT438600	hsa-miR-126-3p	Luciferase reporter assay	24037526
MIRT438600	hsa-miR-126-3p	Luciferase reporter assay	24037526
MIRT438600	hsa-miR-126-3p	Luciferase reporter assay	24037526
MIRT438600	hsa-miR-126-3p	Luciferase reporter assay	24037526
MIRT705885	hsa-miR-3121-3p	HITS-CLIP	23313552
MIRT705884	hsa-miR-660-5p	HITS-CLIP	23313552
MIRT705883	hsa-miR-4495	HITS-CLIP	23313552
MIRT705882	hsa-miR-379-3p	HITS-CLIP	23313552
MIRT705881	hsa-miR-411-3p	HITS-CLIP	23313552
MIRT705880	hsa-miR-380-3p	HITS-CLIP	23313552
MIRT705879	hsa-miR-500b-3p	HITS-CLIP	23313552
MIRT705878	hsa-miR-5087	HITS-CLIP	23313552
MIRT705877	hsa-miR-3924	HITS-CLIP	23313552
MIRT705876	hsa-miR-29b-2-5p	HITS-CLIP	23313552
MIRT482446	hsa-miR-4464	PAR-CLIP	20371350
MIRT482444	hsa-miR-4748	PAR-CLIP	20371350
MIRT482445	hsa-miR-329-5p	PAR-CLIP	20371350
MIRT482443	hsa-miR-3174	PAR-CLIP	20371350
MIRT482442	hsa-miR-5697	PAR-CLIP	20371350
MIRT482441	hsa-miR-877-3p	PAR-CLIP	20371350
MIRT482440	hsa-miR-3975	PAR-CLIP	20371350
MIRT482439	hsa-miR-2467-5p	PAR-CLIP	20371350
MIRT482438	hsa-miR-485-5p	PAR-CLIP	20371350
MIRT482437	hsa-miR-6884-5p	PAR-CLIP	20371350
MIRT482436	hsa-miR-3188	PAR-CLIP	20371350
MIRT482435	hsa-miR-4316	PAR-CLIP	20371350
MIRT482434	hsa-miR-633	PAR-CLIP	20371350
MIRT482433	hsa-miR-921	PAR-CLIP	20371350
MIRT482432	hsa-miR-1297	PAR-CLIP	20371350
MIRT050138	hsa-miR-26a-5p	PAR-CLIP	20371350
MIRT029565	hsa-miR-26b-5p	PAR-CLIP	20371350
MIRT482431	hsa-miR-4465	PAR-CLIP	20371350
MIRT482430	hsa-miR-7111-3p	PAR-CLIP	20371350
MIRT482428	hsa-miR-6780a-3p	PAR-CLIP	20371350
MIRT482429	hsa-miR-6881-3p	PAR-CLIP	20371350
MIRT482427	hsa-miR-3978	PAR-CLIP	20371350
MIRT482426	hsa-miR-6509-5p	PAR-CLIP	20371350
MIRT482425	hsa-miR-670-3p	PAR-CLIP	20371350
MIRT482424	hsa-miR-1238-3p	PAR-CLIP	20371350
MIRT482423	hsa-miR-7850-5p	PAR-CLIP	20371350
MIRT568602	hsa-miR-655-3p	PAR-CLIP	20371350
MIRT568601	hsa-miR-374c-5p	PAR-CLIP	20371350
MIRT568600	hsa-miR-365b-3p	PAR-CLIP	20371350
MIRT568599	hsa-miR-365a-3p	PAR-CLIP	20371350
MIRT568598	hsa-miR-3662	PAR-CLIP	20371350
MIRT568596	hsa-miR-338-5p	PAR-CLIP	20371350
MIRT568595	hsa-miR-4666a-3p	PAR-CLIP	20371350
MIRT568594	hsa-miR-938	PAR-CLIP	20371350
MIRT568593	hsa-miR-6886-3p	PAR-CLIP	20371350
MIRT568592	hsa-miR-3140-3p	PAR-CLIP	20371350
MIRT482446	hsa-miR-4464	PAR-CLIP	20371350
MIRT482444	hsa-miR-4748	PAR-CLIP	20371350
MIRT482445	hsa-miR-329-5p	PAR-CLIP	20371350
MIRT482443	hsa-miR-3174	PAR-CLIP	20371350
MIRT482442	hsa-miR-5697	PAR-CLIP	20371350
MIRT482441	hsa-miR-877-3p	PAR-CLIP	20371350
MIRT482440	hsa-miR-3975	PAR-CLIP	20371350
MIRT482439	hsa-miR-2467-5p	PAR-CLIP	20371350
MIRT482438	hsa-miR-485-5p	PAR-CLIP	20371350
MIRT482437	hsa-miR-6884-5p	PAR-CLIP	20371350
MIRT482436	hsa-miR-3188	PAR-CLIP	20371350
MIRT482435	hsa-miR-4316	PAR-CLIP	20371350
MIRT482434	hsa-miR-633	PAR-CLIP	20371350
MIRT482433	hsa-miR-921	PAR-CLIP	20371350
MIRT482432	hsa-miR-1297	PAR-CLIP	20371350
MIRT050138	hsa-miR-26a-5p	PAR-CLIP	20371350
MIRT029565	hsa-miR-26b-5p	PAR-CLIP	20371350
MIRT482431	hsa-miR-4465	PAR-CLIP	20371350
MIRT482430	hsa-miR-7111-3p	PAR-CLIP	20371350
MIRT482428	hsa-miR-6780a-3p	PAR-CLIP	20371350
MIRT482429	hsa-miR-6881-3p	PAR-CLIP	20371350
MIRT482427	hsa-miR-3978	PAR-CLIP	20371350
MIRT482426	hsa-miR-6509-5p	PAR-CLIP	20371350
MIRT482425	hsa-miR-670-3p	PAR-CLIP	20371350
MIRT482424	hsa-miR-1238-3p	PAR-CLIP	20371350
MIRT482423	hsa-miR-7850-5p	PAR-CLIP	20371350
MIRT568602	hsa-miR-655-3p	PAR-CLIP	20371350
MIRT568601	hsa-miR-374c-5p	PAR-CLIP	20371350
MIRT568600	hsa-miR-365b-3p	PAR-CLIP	20371350
MIRT568599	hsa-miR-365a-3p	PAR-CLIP	20371350
MIRT568598	hsa-miR-3662	PAR-CLIP	20371350
MIRT568597	hsa-miR-302f	PAR-CLIP	20371350
MIRT568596	hsa-miR-338-5p	PAR-CLIP	20371350
MIRT568595	hsa-miR-4666a-3p	PAR-CLIP	20371350
MIRT568594	hsa-miR-938	PAR-CLIP	20371350
MIRT568593	hsa-miR-6886-3p	PAR-CLIP	20371350
MIRT568592	hsa-miR-3140-3p	PAR-CLIP	20371350
MIRT482446	hsa-miR-4464	PAR-CLIP	21572407
MIRT482444	hsa-miR-4748	PAR-CLIP	21572407
MIRT482445	hsa-miR-329-5p	PAR-CLIP	21572407
MIRT482443	hsa-miR-3174	PAR-CLIP	21572407
MIRT482442	hsa-miR-5697	PAR-CLIP	21572407
MIRT482441	hsa-miR-877-3p	PAR-CLIP	21572407
MIRT541500	hsa-miR-4456	PAR-CLIP	21572407
MIRT559722	hsa-miR-4462	PAR-CLIP	21572407
MIRT482440	hsa-miR-3975	PAR-CLIP	21572407
MIRT482439	hsa-miR-2467-5p	PAR-CLIP	21572407
MIRT482438	hsa-miR-485-5p	PAR-CLIP	21572407
MIRT482437	hsa-miR-6884-5p	PAR-CLIP	21572407
MIRT482436	hsa-miR-3188	PAR-CLIP	21572407
MIRT541499	hsa-miR-342-5p	PAR-CLIP	21572407
MIRT541498	hsa-miR-4664-5p	PAR-CLIP	21572407
MIRT541497	hsa-miR-4651	PAR-CLIP	21572407
MIRT541496	hsa-miR-608	PAR-CLIP	21572407
MIRT541495	hsa-miR-6747-5p	PAR-CLIP	21572407
MIRT541494	hsa-miR-541-3p	PAR-CLIP	21572407
MIRT541493	hsa-miR-654-5p	PAR-CLIP	21572407
MIRT541492	hsa-miR-92a-2-5p	PAR-CLIP	21572407
MIRT541491	hsa-miR-6769a-5p	PAR-CLIP	21572407
MIRT541490	hsa-miR-6769b-5p	PAR-CLIP	21572407
MIRT482435	hsa-miR-4316	PAR-CLIP	21572407
MIRT541489	hsa-miR-6742-5p	PAR-CLIP	21572407
MIRT482434	hsa-miR-633	PAR-CLIP	21572407
MIRT482433	hsa-miR-921	PAR-CLIP	21572407
MIRT482432	hsa-miR-1297	PAR-CLIP	21572407
MIRT050138	hsa-miR-26a-5p	PAR-CLIP	21572407
MIRT029565	hsa-miR-26b-5p	PAR-CLIP	21572407
MIRT482431	hsa-miR-4465	PAR-CLIP	21572407
MIRT482430	hsa-miR-7111-3p	PAR-CLIP	21572407
MIRT482428	hsa-miR-6780a-3p	PAR-CLIP	21572407
MIRT482429	hsa-miR-6881-3p	PAR-CLIP	21572407
MIRT482427	hsa-miR-3978	PAR-CLIP	21572407
MIRT541488	hsa-miR-6737-5p	PAR-CLIP	21572407
MIRT541487	hsa-miR-6812-5p	PAR-CLIP	21572407
MIRT541486	hsa-miR-6819-5p	PAR-CLIP	21572407
MIRT482426	hsa-miR-6509-5p	PAR-CLIP	21572407
MIRT482425	hsa-miR-670-3p	PAR-CLIP	21572407
MIRT482424	hsa-miR-1238-3p	PAR-CLIP	21572407
MIRT482423	hsa-miR-7850-5p	PAR-CLIP	21572407
MIRT482446	hsa-miR-4464	PAR-CLIP	21572407
MIRT482444	hsa-miR-4748	PAR-CLIP	21572407
MIRT482445	hsa-miR-329-5p	PAR-CLIP	21572407
MIRT482443	hsa-miR-3174	PAR-CLIP	21572407
MIRT482442	hsa-miR-5697	PAR-CLIP	21572407
MIRT482441	hsa-miR-877-3p	PAR-CLIP	21572407
MIRT482440	hsa-miR-3975	PAR-CLIP	21572407
MIRT482439	hsa-miR-2467-5p	PAR-CLIP	21572407
MIRT482438	hsa-miR-485-5p	PAR-CLIP	21572407
MIRT482437	hsa-miR-6884-5p	PAR-CLIP	21572407
MIRT482436	hsa-miR-3188	PAR-CLIP	21572407
MIRT482435	hsa-miR-4316	PAR-CLIP	21572407
MIRT482434	hsa-miR-633	PAR-CLIP	21572407
MIRT482433	hsa-miR-921	PAR-CLIP	21572407
MIRT482432	hsa-miR-1297	PAR-CLIP	21572407
MIRT050138	hsa-miR-26a-5p	PAR-CLIP	21572407
MIRT029565	hsa-miR-26b-5p	PAR-CLIP	21572407
MIRT482431	hsa-miR-4465	PAR-CLIP	21572407
MIRT482430	hsa-miR-7111-3p	PAR-CLIP	21572407
MIRT482428	hsa-miR-6780a-3p	PAR-CLIP	21572407
MIRT482429	hsa-miR-6881-3p	PAR-CLIP	21572407
MIRT482427	hsa-miR-3978	PAR-CLIP	21572407
MIRT482426	hsa-miR-6509-5p	PAR-CLIP	21572407
MIRT482425	hsa-miR-670-3p	PAR-CLIP	21572407
MIRT482424	hsa-miR-1238-3p	PAR-CLIP	21572407
MIRT482423	hsa-miR-7850-5p	PAR-CLIP	21572407
MIRT482443	hsa-miR-3174	PAR-CLIP	21572407
MIRT482442	hsa-miR-5697	PAR-CLIP	21572407
MIRT541500	hsa-miR-4456	PAR-CLIP	21572407
MIRT482440	hsa-miR-3975	PAR-CLIP	21572407
MIRT482439	hsa-miR-2467-5p	PAR-CLIP	21572407
MIRT482438	hsa-miR-485-5p	PAR-CLIP	21572407
MIRT482437	hsa-miR-6884-5p	PAR-CLIP	21572407
MIRT482436	hsa-miR-3188	PAR-CLIP	21572407
MIRT541499	hsa-miR-342-5p	PAR-CLIP	21572407
MIRT541498	hsa-miR-4664-5p	PAR-CLIP	21572407
MIRT541497	hsa-miR-4651	PAR-CLIP	21572407
MIRT541496	hsa-miR-608	PAR-CLIP	21572407
MIRT541495	hsa-miR-6747-5p	PAR-CLIP	21572407
MIRT541494	hsa-miR-541-3p	PAR-CLIP	21572407
MIRT541493	hsa-miR-654-5p	PAR-CLIP	21572407
MIRT541492	hsa-miR-92a-2-5p	PAR-CLIP	21572407
MIRT541491	hsa-miR-6769a-5p	PAR-CLIP	21572407
MIRT541490	hsa-miR-6769b-5p	PAR-CLIP	21572407
MIRT482435	hsa-miR-4316	PAR-CLIP	21572407
MIRT541489	hsa-miR-6742-5p	PAR-CLIP	21572407
MIRT482434	hsa-miR-633	PAR-CLIP	21572407
MIRT482433	hsa-miR-921	PAR-CLIP	21572407
MIRT482432	hsa-miR-1297	PAR-CLIP	21572407
MIRT050138	hsa-miR-26a-5p	PAR-CLIP	21572407
MIRT029565	hsa-miR-26b-5p	PAR-CLIP	21572407
MIRT482431	hsa-miR-4465	PAR-CLIP	21572407
MIRT482427	hsa-miR-3978	PAR-CLIP	21572407
MIRT541488	hsa-miR-6737-5p	PAR-CLIP	21572407
MIRT541487	hsa-miR-6812-5p	PAR-CLIP	21572407
MIRT541486	hsa-miR-6819-5p	PAR-CLIP	21572407
MIRT482446	hsa-miR-4464	PAR-CLIP	22012620
MIRT482444	hsa-miR-4748	PAR-CLIP	22012620
MIRT482445	hsa-miR-329-5p	PAR-CLIP	22012620
MIRT482443	hsa-miR-3174	PAR-CLIP	22012620
MIRT482442	hsa-miR-5697	PAR-CLIP	22012620
MIRT482441	hsa-miR-877-3p	PAR-CLIP	22012620
MIRT482440	hsa-miR-3975	PAR-CLIP	22012620
MIRT482439	hsa-miR-2467-5p	PAR-CLIP	22012620
MIRT482438	hsa-miR-485-5p	PAR-CLIP	22012620
MIRT482437	hsa-miR-6884-5p	PAR-CLIP	22012620
MIRT482436	hsa-miR-3188	PAR-CLIP	22012620
MIRT482435	hsa-miR-4316	PAR-CLIP	22012620
MIRT482434	hsa-miR-633	PAR-CLIP	22012620
MIRT482433	hsa-miR-921	PAR-CLIP	22012620
MIRT482432	hsa-miR-1297	PAR-CLIP	22012620
MIRT050138	hsa-miR-26a-5p	PAR-CLIP	22012620
MIRT029565	hsa-miR-26b-5p	PAR-CLIP	22012620
MIRT482431	hsa-miR-4465	PAR-CLIP	22012620
MIRT482430	hsa-miR-7111-3p	PAR-CLIP	22012620
MIRT482428	hsa-miR-6780a-3p	PAR-CLIP	22012620
MIRT482429	hsa-miR-6881-3p	PAR-CLIP	22012620
MIRT482427	hsa-miR-3978	PAR-CLIP	22012620
MIRT482426	hsa-miR-6509-5p	PAR-CLIP	22012620
MIRT482425	hsa-miR-670-3p	PAR-CLIP	22012620
MIRT482424	hsa-miR-1238-3p	PAR-CLIP	22012620
MIRT482423	hsa-miR-7850-5p	PAR-CLIP	22012620
MIRT482446	hsa-miR-4464	PAR-CLIP	23446348
MIRT482444	hsa-miR-4748	PAR-CLIP	23446348
MIRT482445	hsa-miR-329-5p	PAR-CLIP	23446348
MIRT482443	hsa-miR-3174	PAR-CLIP	23446348
MIRT482442	hsa-miR-5697	PAR-CLIP	23446348
MIRT482441	hsa-miR-877-3p	PAR-CLIP	23446348
MIRT482440	hsa-miR-3975	PAR-CLIP	23446348
MIRT482439	hsa-miR-2467-5p	PAR-CLIP	23446348
MIRT482438	hsa-miR-485-5p	PAR-CLIP	23446348
MIRT482437	hsa-miR-6884-5p	PAR-CLIP	23446348
MIRT482436	hsa-miR-3188	PAR-CLIP	23446348
MIRT482435	hsa-miR-4316	PAR-CLIP	23446348
MIRT482434	hsa-miR-633	PAR-CLIP	23446348
MIRT482433	hsa-miR-921	PAR-CLIP	23446348
MIRT482432	hsa-miR-1297	PAR-CLIP	23446348
MIRT050138	hsa-miR-26a-5p	PAR-CLIP	23446348
MIRT029565	hsa-miR-26b-5p	PAR-CLIP	23446348
MIRT482431	hsa-miR-4465	PAR-CLIP	23446348
MIRT482430	hsa-miR-7111-3p	PAR-CLIP	23446348
MIRT482428	hsa-miR-6780a-3p	PAR-CLIP	23446348
MIRT482429	hsa-miR-6881-3p	PAR-CLIP	23446348
MIRT482427	hsa-miR-3978	PAR-CLIP	23446348
MIRT482426	hsa-miR-6509-5p	PAR-CLIP	23446348
MIRT482425	hsa-miR-670-3p	PAR-CLIP	23446348
MIRT482424	hsa-miR-1238-3p	PAR-CLIP	23446348
MIRT482423	hsa-miR-7850-5p	PAR-CLIP	23446348
MIRT482446	hsa-miR-4464	PAR-CLIP	23592263
MIRT482444	hsa-miR-4748	PAR-CLIP	23592263
MIRT482445	hsa-miR-329-5p	PAR-CLIP	23592263
MIRT482443	hsa-miR-3174	PAR-CLIP	23592263
MIRT482442	hsa-miR-5697	PAR-CLIP	23592263
MIRT482441	hsa-miR-877-3p	PAR-CLIP	23592263
MIRT482440	hsa-miR-3975	PAR-CLIP	23592263
MIRT482439	hsa-miR-2467-5p	PAR-CLIP	23592263
MIRT482438	hsa-miR-485-5p	PAR-CLIP	23592263
MIRT482437	hsa-miR-6884-5p	PAR-CLIP	23592263
MIRT482436	hsa-miR-3188	PAR-CLIP	23592263
MIRT482435	hsa-miR-4316	PAR-CLIP	23592263
MIRT482434	hsa-miR-633	PAR-CLIP	23592263
MIRT482433	hsa-miR-921	PAR-CLIP	23592263
MIRT482432	hsa-miR-1297	PAR-CLIP	23592263
MIRT050138	hsa-miR-26a-5p	PAR-CLIP	23592263
MIRT029565	hsa-miR-26b-5p	PAR-CLIP	23592263
MIRT482431	hsa-miR-4465	PAR-CLIP	23592263
MIRT482430	hsa-miR-7111-3p	PAR-CLIP	23592263
MIRT482428	hsa-miR-6780a-3p	PAR-CLIP	23592263
MIRT482429	hsa-miR-6881-3p	PAR-CLIP	23592263
MIRT482427	hsa-miR-3978	PAR-CLIP	23592263
MIRT482426	hsa-miR-6509-5p	PAR-CLIP	23592263
MIRT482425	hsa-miR-670-3p	PAR-CLIP	23592263
MIRT482424	hsa-miR-1238-3p	PAR-CLIP	23592263
MIRT482423	hsa-miR-7850-5p	PAR-CLIP	23592263
MIRT482446	hsa-miR-4464	PAR-CLIP	23592263
MIRT482444	hsa-miR-4748	PAR-CLIP	23592263
MIRT482445	hsa-miR-329-5p	PAR-CLIP	23592263
MIRT482443	hsa-miR-3174	PAR-CLIP	23592263
MIRT482442	hsa-miR-5697	PAR-CLIP	23592263
MIRT482441	hsa-miR-877-3p	PAR-CLIP	23592263
MIRT482440	hsa-miR-3975	PAR-CLIP	23592263
MIRT482439	hsa-miR-2467-5p	PAR-CLIP	23592263
MIRT482438	hsa-miR-485-5p	PAR-CLIP	23592263
MIRT482437	hsa-miR-6884-5p	PAR-CLIP	23592263
MIRT482436	hsa-miR-3188	PAR-CLIP	23592263
MIRT482435	hsa-miR-4316	PAR-CLIP	23592263
MIRT482434	hsa-miR-633	PAR-CLIP	23592263
MIRT482433	hsa-miR-921	PAR-CLIP	23592263
MIRT482432	hsa-miR-1297	PAR-CLIP	23592263
MIRT050138	hsa-miR-26a-5p	PAR-CLIP	23592263
MIRT029565	hsa-miR-26b-5p	PAR-CLIP	23592263
MIRT482431	hsa-miR-4465	PAR-CLIP	23592263
MIRT482430	hsa-miR-7111-3p	PAR-CLIP	23592263
MIRT482428	hsa-miR-6780a-3p	PAR-CLIP	23592263
MIRT482429	hsa-miR-6881-3p	PAR-CLIP	23592263
MIRT482427	hsa-miR-3978	PAR-CLIP	23592263
MIRT482426	hsa-miR-6509-5p	PAR-CLIP	23592263
MIRT482425	hsa-miR-670-3p	PAR-CLIP	23592263
MIRT482424	hsa-miR-1238-3p	PAR-CLIP	23592263
MIRT482423	hsa-miR-7850-5p	PAR-CLIP	23592263
MIRT447451	hsa-miR-548c-3p	PAR-CLIP	22100165
MIRT447450	hsa-miR-3120-3p	PAR-CLIP	22100165
MIRT447449	hsa-miR-3613-3p	PAR-CLIP	22100165
MIRT447448	hsa-miR-4670-3p	PAR-CLIP	22100165
MIRT447447	hsa-miR-2277-3p	PAR-CLIP	22100165
MIRT447446	hsa-miR-520d-5p	PAR-CLIP	22100165
MIRT447445	hsa-miR-524-5p	PAR-CLIP	22100165
MIRT450389	hsa-miR-3616-5p	PAR-CLIP	22100165
MIRT450388	hsa-miR-573	PAR-CLIP	22100165
MIRT447451	hsa-miR-548c-3p	PAR-CLIP	22100165
MIRT447450	hsa-miR-3120-3p	PAR-CLIP	22100165
MIRT447449	hsa-miR-3613-3p	PAR-CLIP	22100165
MIRT447448	hsa-miR-4670-3p	PAR-CLIP	22100165
MIRT447447	hsa-miR-2277-3p	PAR-CLIP	22100165
MIRT447446	hsa-miR-520d-5p	PAR-CLIP	22100165
MIRT447445	hsa-miR-524-5p	PAR-CLIP	22100165
MIRT441259	hsa-miR-382-5p	HITS-CLIP	24374217
MIRT441260	hsa-miR-127-5p	HITS-CLIP	24374217
MIRT441258	hsa-miR-544a	HITS-CLIP	24374217
MIRT441259	hsa-miR-382-5p	HITS-CLIP	24374217
MIRT441260	hsa-miR-127-5p	HITS-CLIP	24374217
MIRT441258	hsa-miR-544a	HITS-CLIP	24374217
MIRT482424	hsa-miR-1238-3p	PAR-CLIP	26701625
MIRT482424	hsa-miR-1238-3p	PAR-CLIP	26701625
MIRT482432	hsa-miR-1297	PAR-CLIP	26701625
MIRT482432	hsa-miR-1297	PAR-CLIP	26701625
MIRT482439	hsa-miR-2467-5p	PAR-CLIP	26701625
MIRT482439	hsa-miR-2467-5p	PAR-CLIP	26701625
MIRT050138	hsa-miR-26a-5p	PAR-CLIP	26701625
MIRT050138	hsa-miR-26a-5p	PAR-CLIP	26701625
MIRT029565	hsa-miR-26b-5p	PAR-CLIP	26701625
MIRT029565	hsa-miR-26b-5p	PAR-CLIP	26701625
MIRT482443	hsa-miR-3174	PAR-CLIP	26701625
MIRT482443	hsa-miR-3174	PAR-CLIP	26701625
MIRT482436	hsa-miR-3188	PAR-CLIP	26701625
MIRT482436	hsa-miR-3188	PAR-CLIP	26701625
MIRT482445	hsa-miR-329-5p	PAR-CLIP	26701625
MIRT482445	hsa-miR-329-5p	PAR-CLIP	26701625
MIRT482440	hsa-miR-3975	PAR-CLIP	26701625
MIRT482440	hsa-miR-3975	PAR-CLIP	26701625
MIRT482427	hsa-miR-3978	PAR-CLIP	26701625
MIRT482427	hsa-miR-3978	PAR-CLIP	26701625
MIRT482435	hsa-miR-4316	PAR-CLIP	26701625
MIRT482435	hsa-miR-4316	PAR-CLIP	26701625
MIRT482446	hsa-miR-4464	PAR-CLIP	26701625
MIRT482446	hsa-miR-4464	PAR-CLIP	26701625
MIRT482431	hsa-miR-4465	PAR-CLIP	26701625
MIRT482431	hsa-miR-4465	PAR-CLIP	26701625
MIRT482444	hsa-miR-4748	PAR-CLIP	26701625
MIRT482444	hsa-miR-4748	PAR-CLIP	26701625
MIRT482438	hsa-miR-485-5p	PAR-CLIP	26701625
MIRT482438	hsa-miR-485-5p	PAR-CLIP	26701625
MIRT482442	hsa-miR-5697	PAR-CLIP	26701625
MIRT482442	hsa-miR-5697	PAR-CLIP	26701625
MIRT482434	hsa-miR-633	PAR-CLIP	26701625
MIRT482434	hsa-miR-633	PAR-CLIP	26701625
MIRT482426	hsa-miR-6509-5p	PAR-CLIP	26701625
MIRT482426	hsa-miR-6509-5p	PAR-CLIP	26701625
MIRT482425	hsa-miR-670-3p	PAR-CLIP	26701625
MIRT482425	hsa-miR-670-3p	PAR-CLIP	26701625
MIRT482428	hsa-miR-6780a-3p	PAR-CLIP	26701625
MIRT482428	hsa-miR-6780a-3p	PAR-CLIP	26701625
MIRT482429	hsa-miR-6881-3p	PAR-CLIP	26701625
MIRT482429	hsa-miR-6881-3p	PAR-CLIP	26701625
MIRT482437	hsa-miR-6884-5p	PAR-CLIP	26701625
MIRT482437	hsa-miR-6884-5p	PAR-CLIP	26701625
MIRT482430	hsa-miR-7111-3p	PAR-CLIP	26701625
MIRT482430	hsa-miR-7111-3p	PAR-CLIP	26701625
MIRT482423	hsa-miR-7850-5p	PAR-CLIP	26701625
MIRT482423	hsa-miR-7850-5p	PAR-CLIP	26701625
MIRT482441	hsa-miR-877-3p	PAR-CLIP	26701625
MIRT482441	hsa-miR-877-3p	PAR-CLIP	26701625
MIRT482433	hsa-miR-921	PAR-CLIP	26701625
MIRT482433	hsa-miR-921	PAR-CLIP	26701625
MIRT734519	hsa-miR-574-3p	Luciferase reporter assay, qRT-PCR	32412065
MIRT705885	hsa-miR-3121-3p	HITS-CLIP	23313552
MIRT705884	hsa-miR-660-5p	HITS-CLIP	23313552
MIRT705883	hsa-miR-4495	HITS-CLIP	23313552
MIRT705882	hsa-miR-379-3p	HITS-CLIP	23313552
MIRT705881	hsa-miR-411-3p	HITS-CLIP	23313552
MIRT705880	hsa-miR-380-3p	HITS-CLIP	23313552
MIRT705879	hsa-miR-500b-3p	HITS-CLIP	23313552
MIRT705878	hsa-miR-5087	HITS-CLIP	23313552
MIRT705877	hsa-miR-3924	HITS-CLIP	23313552
MIRT705876	hsa-miR-29b-2-5p	HITS-CLIP	23313552
MIRT482446	hsa-miR-4464	PAR-CLIP	20371350
MIRT482444	hsa-miR-4748	PAR-CLIP	20371350
MIRT482445	hsa-miR-329-5p	PAR-CLIP	20371350
MIRT482443	hsa-miR-3174	PAR-CLIP	20371350
MIRT482442	hsa-miR-5697	PAR-CLIP	20371350
MIRT482441	hsa-miR-877-3p	PAR-CLIP	20371350
MIRT482440	hsa-miR-3975	PAR-CLIP	20371350
MIRT482439	hsa-miR-2467-5p	PAR-CLIP	20371350
MIRT482438	hsa-miR-485-5p	PAR-CLIP	20371350
MIRT482437	hsa-miR-6884-5p	PAR-CLIP	20371350
MIRT482436	hsa-miR-3188	PAR-CLIP	20371350
MIRT482435	hsa-miR-4316	PAR-CLIP	20371350
MIRT482434	hsa-miR-633	PAR-CLIP	20371350
MIRT482433	hsa-miR-921	PAR-CLIP	20371350
MIRT482432	hsa-miR-1297	PAR-CLIP	20371350
MIRT050138	hsa-miR-26a-5p	PAR-CLIP	20371350
MIRT029565	hsa-miR-26b-5p	PAR-CLIP	20371350
MIRT482431	hsa-miR-4465	PAR-CLIP	20371350
MIRT482430	hsa-miR-7111-3p	PAR-CLIP	20371350
MIRT482428	hsa-miR-6780a-3p	PAR-CLIP	20371350
MIRT482429	hsa-miR-6881-3p	PAR-CLIP	20371350
MIRT482427	hsa-miR-3978	PAR-CLIP	20371350
MIRT482426	hsa-miR-6509-5p	PAR-CLIP	20371350
MIRT482425	hsa-miR-670-3p	PAR-CLIP	20371350
MIRT482424	hsa-miR-1238-3p	PAR-CLIP	20371350
MIRT482423	hsa-miR-7850-5p	PAR-CLIP	20371350
MIRT568602	hsa-miR-655-3p	PAR-CLIP	20371350
MIRT568601	hsa-miR-374c-5p	PAR-CLIP	20371350
MIRT568600	hsa-miR-365b-3p	PAR-CLIP	20371350
MIRT568599	hsa-miR-365a-3p	PAR-CLIP	20371350
MIRT568598	hsa-miR-3662	PAR-CLIP	20371350
MIRT568596	hsa-miR-338-5p	PAR-CLIP	20371350
MIRT568595	hsa-miR-4666a-3p	PAR-CLIP	20371350
MIRT568594	hsa-miR-938	PAR-CLIP	20371350
MIRT568593	hsa-miR-6886-3p	PAR-CLIP	20371350
MIRT568592	hsa-miR-3140-3p	PAR-CLIP	20371350
MIRT482446	hsa-miR-4464	PAR-CLIP	20371350
MIRT482444	hsa-miR-4748	PAR-CLIP	20371350
MIRT482445	hsa-miR-329-5p	PAR-CLIP	20371350
MIRT482443	hsa-miR-3174	PAR-CLIP	20371350
MIRT482442	hsa-miR-5697	PAR-CLIP	20371350
MIRT482441	hsa-miR-877-3p	PAR-CLIP	20371350
MIRT482440	hsa-miR-3975	PAR-CLIP	20371350
MIRT482439	hsa-miR-2467-5p	PAR-CLIP	20371350
MIRT482438	hsa-miR-485-5p	PAR-CLIP	20371350
MIRT482437	hsa-miR-6884-5p	PAR-CLIP	20371350
MIRT482436	hsa-miR-3188	PAR-CLIP	20371350
MIRT482435	hsa-miR-4316	PAR-CLIP	20371350
MIRT482434	hsa-miR-633	PAR-CLIP	20371350
MIRT482433	hsa-miR-921	PAR-CLIP	20371350
MIRT482432	hsa-miR-1297	PAR-CLIP	20371350
MIRT050138	hsa-miR-26a-5p	PAR-CLIP	20371350
MIRT029565	hsa-miR-26b-5p	PAR-CLIP	20371350
MIRT482431	hsa-miR-4465	PAR-CLIP	20371350
MIRT482430	hsa-miR-7111-3p	PAR-CLIP	20371350
MIRT482428	hsa-miR-6780a-3p	PAR-CLIP	20371350
MIRT482429	hsa-miR-6881-3p	PAR-CLIP	20371350
MIRT482427	hsa-miR-3978	PAR-CLIP	20371350
MIRT482426	hsa-miR-6509-5p	PAR-CLIP	20371350
MIRT482425	hsa-miR-670-3p	PAR-CLIP	20371350
MIRT482424	hsa-miR-1238-3p	PAR-CLIP	20371350
MIRT482423	hsa-miR-7850-5p	PAR-CLIP	20371350
MIRT568602	hsa-miR-655-3p	PAR-CLIP	20371350
MIRT568601	hsa-miR-374c-5p	PAR-CLIP	20371350
MIRT568600	hsa-miR-365b-3p	PAR-CLIP	20371350
MIRT568599	hsa-miR-365a-3p	PAR-CLIP	20371350
MIRT568598	hsa-miR-3662	PAR-CLIP	20371350
MIRT568597	hsa-miR-302f	PAR-CLIP	20371350
MIRT568596	hsa-miR-338-5p	PAR-CLIP	20371350
MIRT568595	hsa-miR-4666a-3p	PAR-CLIP	20371350
MIRT568594	hsa-miR-938	PAR-CLIP	20371350
MIRT568593	hsa-miR-6886-3p	PAR-CLIP	20371350
MIRT568592	hsa-miR-3140-3p	PAR-CLIP	20371350
MIRT482446	hsa-miR-4464	PAR-CLIP	21572407
MIRT482444	hsa-miR-4748	PAR-CLIP	21572407
MIRT482445	hsa-miR-329-5p	PAR-CLIP	21572407
MIRT482443	hsa-miR-3174	PAR-CLIP	21572407
MIRT482442	hsa-miR-5697	PAR-CLIP	21572407
MIRT482441	hsa-miR-877-3p	PAR-CLIP	21572407
MIRT541500	hsa-miR-4456	PAR-CLIP	21572407
MIRT559722	hsa-miR-4462	PAR-CLIP	21572407
MIRT482440	hsa-miR-3975	PAR-CLIP	21572407
MIRT482439	hsa-miR-2467-5p	PAR-CLIP	21572407
MIRT482438	hsa-miR-485-5p	PAR-CLIP	21572407
MIRT482437	hsa-miR-6884-5p	PAR-CLIP	21572407
MIRT482436	hsa-miR-3188	PAR-CLIP	21572407
MIRT541499	hsa-miR-342-5p	PAR-CLIP	21572407
MIRT541498	hsa-miR-4664-5p	PAR-CLIP	21572407
MIRT541497	hsa-miR-4651	PAR-CLIP	21572407
MIRT541496	hsa-miR-608	PAR-CLIP	21572407
MIRT541495	hsa-miR-6747-5p	PAR-CLIP	21572407
MIRT541494	hsa-miR-541-3p	PAR-CLIP	21572407
MIRT541493	hsa-miR-654-5p	PAR-CLIP	21572407
MIRT541492	hsa-miR-92a-2-5p	PAR-CLIP	21572407
MIRT541491	hsa-miR-6769a-5p	PAR-CLIP	21572407
MIRT541490	hsa-miR-6769b-5p	PAR-CLIP	21572407
MIRT482435	hsa-miR-4316	PAR-CLIP	21572407
MIRT541489	hsa-miR-6742-5p	PAR-CLIP	21572407
MIRT482434	hsa-miR-633	PAR-CLIP	21572407
MIRT482433	hsa-miR-921	PAR-CLIP	21572407
MIRT482432	hsa-miR-1297	PAR-CLIP	21572407
MIRT050138	hsa-miR-26a-5p	PAR-CLIP	21572407
MIRT029565	hsa-miR-26b-5p	PAR-CLIP	21572407
MIRT482431	hsa-miR-4465	PAR-CLIP	21572407
MIRT482430	hsa-miR-7111-3p	PAR-CLIP	21572407
MIRT482428	hsa-miR-6780a-3p	PAR-CLIP	21572407
MIRT482429	hsa-miR-6881-3p	PAR-CLIP	21572407
MIRT482427	hsa-miR-3978	PAR-CLIP	21572407
MIRT541488	hsa-miR-6737-5p	PAR-CLIP	21572407
MIRT541487	hsa-miR-6812-5p	PAR-CLIP	21572407
MIRT541486	hsa-miR-6819-5p	PAR-CLIP	21572407
MIRT482426	hsa-miR-6509-5p	PAR-CLIP	21572407
MIRT482425	hsa-miR-670-3p	PAR-CLIP	21572407
MIRT482424	hsa-miR-1238-3p	PAR-CLIP	21572407
MIRT482423	hsa-miR-7850-5p	PAR-CLIP	21572407
MIRT482446	hsa-miR-4464	PAR-CLIP	21572407
MIRT482444	hsa-miR-4748	PAR-CLIP	21572407
MIRT482445	hsa-miR-329-5p	PAR-CLIP	21572407
MIRT482443	hsa-miR-3174	PAR-CLIP	21572407
MIRT482442	hsa-miR-5697	PAR-CLIP	21572407
MIRT482441	hsa-miR-877-3p	PAR-CLIP	21572407
MIRT482440	hsa-miR-3975	PAR-CLIP	21572407
MIRT482439	hsa-miR-2467-5p	PAR-CLIP	21572407
MIRT482438	hsa-miR-485-5p	PAR-CLIP	21572407
MIRT482437	hsa-miR-6884-5p	PAR-CLIP	21572407
MIRT482436	hsa-miR-3188	PAR-CLIP	21572407
MIRT482435	hsa-miR-4316	PAR-CLIP	21572407
MIRT482434	hsa-miR-633	PAR-CLIP	21572407
MIRT482433	hsa-miR-921	PAR-CLIP	21572407
MIRT482432	hsa-miR-1297	PAR-CLIP	21572407
MIRT050138	hsa-miR-26a-5p	PAR-CLIP	21572407
MIRT029565	hsa-miR-26b-5p	PAR-CLIP	21572407
MIRT482431	hsa-miR-4465	PAR-CLIP	21572407
MIRT482430	hsa-miR-7111-3p	PAR-CLIP	21572407
MIRT482428	hsa-miR-6780a-3p	PAR-CLIP	21572407
MIRT482429	hsa-miR-6881-3p	PAR-CLIP	21572407
MIRT482427	hsa-miR-3978	PAR-CLIP	21572407
MIRT482426	hsa-miR-6509-5p	PAR-CLIP	21572407
MIRT482425	hsa-miR-670-3p	PAR-CLIP	21572407
MIRT482424	hsa-miR-1238-3p	PAR-CLIP	21572407
MIRT482423	hsa-miR-7850-5p	PAR-CLIP	21572407
MIRT482443	hsa-miR-3174	PAR-CLIP	21572407
MIRT482442	hsa-miR-5697	PAR-CLIP	21572407
MIRT541500	hsa-miR-4456	PAR-CLIP	21572407
MIRT482440	hsa-miR-3975	PAR-CLIP	21572407
MIRT482439	hsa-miR-2467-5p	PAR-CLIP	21572407
MIRT482438	hsa-miR-485-5p	PAR-CLIP	21572407
MIRT482437	hsa-miR-6884-5p	PAR-CLIP	21572407
MIRT482436	hsa-miR-3188	PAR-CLIP	21572407
MIRT541499	hsa-miR-342-5p	PAR-CLIP	21572407
MIRT541498	hsa-miR-4664-5p	PAR-CLIP	21572407
MIRT541497	hsa-miR-4651	PAR-CLIP	21572407
MIRT541496	hsa-miR-608	PAR-CLIP	21572407
MIRT541495	hsa-miR-6747-5p	PAR-CLIP	21572407
MIRT541494	hsa-miR-541-3p	PAR-CLIP	21572407
MIRT541493	hsa-miR-654-5p	PAR-CLIP	21572407
MIRT541492	hsa-miR-92a-2-5p	PAR-CLIP	21572407
MIRT541491	hsa-miR-6769a-5p	PAR-CLIP	21572407
MIRT541490	hsa-miR-6769b-5p	PAR-CLIP	21572407
MIRT482435	hsa-miR-4316	PAR-CLIP	21572407
MIRT541489	hsa-miR-6742-5p	PAR-CLIP	21572407
MIRT482434	hsa-miR-633	PAR-CLIP	21572407
MIRT482433	hsa-miR-921	PAR-CLIP	21572407
MIRT482432	hsa-miR-1297	PAR-CLIP	21572407
MIRT050138	hsa-miR-26a-5p	PAR-CLIP	21572407
MIRT029565	hsa-miR-26b-5p	PAR-CLIP	21572407
MIRT482431	hsa-miR-4465	PAR-CLIP	21572407
MIRT482427	hsa-miR-3978	PAR-CLIP	21572407
MIRT541488	hsa-miR-6737-5p	PAR-CLIP	21572407
MIRT541487	hsa-miR-6812-5p	PAR-CLIP	21572407
MIRT541486	hsa-miR-6819-5p	PAR-CLIP	21572407
MIRT482446	hsa-miR-4464	PAR-CLIP	22012620
MIRT482444	hsa-miR-4748	PAR-CLIP	22012620
MIRT482445	hsa-miR-329-5p	PAR-CLIP	22012620
MIRT482443	hsa-miR-3174	PAR-CLIP	22012620
MIRT482442	hsa-miR-5697	PAR-CLIP	22012620
MIRT482441	hsa-miR-877-3p	PAR-CLIP	22012620
MIRT482440	hsa-miR-3975	PAR-CLIP	22012620
MIRT482439	hsa-miR-2467-5p	PAR-CLIP	22012620
MIRT482438	hsa-miR-485-5p	PAR-CLIP	22012620
MIRT482437	hsa-miR-6884-5p	PAR-CLIP	22012620
MIRT482436	hsa-miR-3188	PAR-CLIP	22012620
MIRT482435	hsa-miR-4316	PAR-CLIP	22012620
MIRT482434	hsa-miR-633	PAR-CLIP	22012620
MIRT482433	hsa-miR-921	PAR-CLIP	22012620
MIRT482432	hsa-miR-1297	PAR-CLIP	22012620
MIRT050138	hsa-miR-26a-5p	PAR-CLIP	22012620
MIRT029565	hsa-miR-26b-5p	PAR-CLIP	22012620
MIRT482431	hsa-miR-4465	PAR-CLIP	22012620
MIRT482430	hsa-miR-7111-3p	PAR-CLIP	22012620
MIRT482428	hsa-miR-6780a-3p	PAR-CLIP	22012620
MIRT482429	hsa-miR-6881-3p	PAR-CLIP	22012620
MIRT482427	hsa-miR-3978	PAR-CLIP	22012620
MIRT482426	hsa-miR-6509-5p	PAR-CLIP	22012620
MIRT482425	hsa-miR-670-3p	PAR-CLIP	22012620
MIRT482424	hsa-miR-1238-3p	PAR-CLIP	22012620
MIRT482423	hsa-miR-7850-5p	PAR-CLIP	22012620
MIRT482446	hsa-miR-4464	PAR-CLIP	23446348
MIRT482444	hsa-miR-4748	PAR-CLIP	23446348
MIRT482445	hsa-miR-329-5p	PAR-CLIP	23446348
MIRT482443	hsa-miR-3174	PAR-CLIP	23446348
MIRT482442	hsa-miR-5697	PAR-CLIP	23446348
MIRT482441	hsa-miR-877-3p	PAR-CLIP	23446348
MIRT482440	hsa-miR-3975	PAR-CLIP	23446348
MIRT482439	hsa-miR-2467-5p	PAR-CLIP	23446348
MIRT482438	hsa-miR-485-5p	PAR-CLIP	23446348
MIRT482437	hsa-miR-6884-5p	PAR-CLIP	23446348
MIRT482436	hsa-miR-3188	PAR-CLIP	23446348
MIRT482435	hsa-miR-4316	PAR-CLIP	23446348
MIRT482434	hsa-miR-633	PAR-CLIP	23446348
MIRT482433	hsa-miR-921	PAR-CLIP	23446348
MIRT482432	hsa-miR-1297	PAR-CLIP	23446348
MIRT050138	hsa-miR-26a-5p	PAR-CLIP	23446348
MIRT029565	hsa-miR-26b-5p	PAR-CLIP	23446348
MIRT482431	hsa-miR-4465	PAR-CLIP	23446348
MIRT482430	hsa-miR-7111-3p	PAR-CLIP	23446348
MIRT482428	hsa-miR-6780a-3p	PAR-CLIP	23446348
MIRT482429	hsa-miR-6881-3p	PAR-CLIP	23446348
MIRT482427	hsa-miR-3978	PAR-CLIP	23446348
MIRT482426	hsa-miR-6509-5p	PAR-CLIP	23446348
MIRT482425	hsa-miR-670-3p	PAR-CLIP	23446348
MIRT482424	hsa-miR-1238-3p	PAR-CLIP	23446348
MIRT482423	hsa-miR-7850-5p	PAR-CLIP	23446348
MIRT482446	hsa-miR-4464	PAR-CLIP	23592263
MIRT482444	hsa-miR-4748	PAR-CLIP	23592263
MIRT482445	hsa-miR-329-5p	PAR-CLIP	23592263
MIRT482443	hsa-miR-3174	PAR-CLIP	23592263
MIRT482442	hsa-miR-5697	PAR-CLIP	23592263
MIRT482441	hsa-miR-877-3p	PAR-CLIP	23592263
MIRT482440	hsa-miR-3975	PAR-CLIP	23592263
MIRT482439	hsa-miR-2467-5p	PAR-CLIP	23592263
MIRT482438	hsa-miR-485-5p	PAR-CLIP	23592263
MIRT482437	hsa-miR-6884-5p	PAR-CLIP	23592263
MIRT482436	hsa-miR-3188	PAR-CLIP	23592263
MIRT482435	hsa-miR-4316	PAR-CLIP	23592263
MIRT482434	hsa-miR-633	PAR-CLIP	23592263
MIRT482433	hsa-miR-921	PAR-CLIP	23592263
MIRT482432	hsa-miR-1297	PAR-CLIP	23592263
MIRT050138	hsa-miR-26a-5p	PAR-CLIP	23592263
MIRT029565	hsa-miR-26b-5p	PAR-CLIP	23592263
MIRT482431	hsa-miR-4465	PAR-CLIP	23592263
MIRT482430	hsa-miR-7111-3p	PAR-CLIP	23592263
MIRT482428	hsa-miR-6780a-3p	PAR-CLIP	23592263
MIRT482429	hsa-miR-6881-3p	PAR-CLIP	23592263
MIRT482427	hsa-miR-3978	PAR-CLIP	23592263
MIRT482426	hsa-miR-6509-5p	PAR-CLIP	23592263
MIRT482425	hsa-miR-670-3p	PAR-CLIP	23592263
MIRT482424	hsa-miR-1238-3p	PAR-CLIP	23592263
MIRT482423	hsa-miR-7850-5p	PAR-CLIP	23592263
MIRT482446	hsa-miR-4464	PAR-CLIP	23592263
MIRT482444	hsa-miR-4748	PAR-CLIP	23592263
MIRT482445	hsa-miR-329-5p	PAR-CLIP	23592263
MIRT482443	hsa-miR-3174	PAR-CLIP	23592263
MIRT482442	hsa-miR-5697	PAR-CLIP	23592263
MIRT482441	hsa-miR-877-3p	PAR-CLIP	23592263
MIRT482440	hsa-miR-3975	PAR-CLIP	23592263
MIRT482439	hsa-miR-2467-5p	PAR-CLIP	23592263
MIRT482438	hsa-miR-485-5p	PAR-CLIP	23592263
MIRT482437	hsa-miR-6884-5p	PAR-CLIP	23592263
MIRT482436	hsa-miR-3188	PAR-CLIP	23592263
MIRT482435	hsa-miR-4316	PAR-CLIP	23592263
MIRT482434	hsa-miR-633	PAR-CLIP	23592263
MIRT482433	hsa-miR-921	PAR-CLIP	23592263
MIRT482432	hsa-miR-1297	PAR-CLIP	23592263
MIRT050138	hsa-miR-26a-5p	PAR-CLIP	23592263
MIRT029565	hsa-miR-26b-5p	PAR-CLIP	23592263
MIRT482431	hsa-miR-4465	PAR-CLIP	23592263
MIRT482430	hsa-miR-7111-3p	PAR-CLIP	23592263
MIRT482428	hsa-miR-6780a-3p	PAR-CLIP	23592263
MIRT482429	hsa-miR-6881-3p	PAR-CLIP	23592263
MIRT482427	hsa-miR-3978	PAR-CLIP	23592263
MIRT482426	hsa-miR-6509-5p	PAR-CLIP	23592263
MIRT482425	hsa-miR-670-3p	PAR-CLIP	23592263
MIRT482424	hsa-miR-1238-3p	PAR-CLIP	23592263
MIRT482423	hsa-miR-7850-5p	PAR-CLIP	23592263
MIRT447451	hsa-miR-548c-3p	PAR-CLIP	22100165
MIRT447450	hsa-miR-3120-3p	PAR-CLIP	22100165
MIRT447449	hsa-miR-3613-3p	PAR-CLIP	22100165
MIRT447448	hsa-miR-4670-3p	PAR-CLIP	22100165
MIRT447447	hsa-miR-2277-3p	PAR-CLIP	22100165
MIRT447446	hsa-miR-520d-5p	PAR-CLIP	22100165
MIRT447445	hsa-miR-524-5p	PAR-CLIP	22100165
MIRT450389	hsa-miR-3616-5p	PAR-CLIP	22100165
MIRT450388	hsa-miR-573	PAR-CLIP	22100165
MIRT447451	hsa-miR-548c-3p	PAR-CLIP	22100165
MIRT447450	hsa-miR-3120-3p	PAR-CLIP	22100165
MIRT447449	hsa-miR-3613-3p	PAR-CLIP	22100165
MIRT447448	hsa-miR-4670-3p	PAR-CLIP	22100165
MIRT447447	hsa-miR-2277-3p	PAR-CLIP	22100165
MIRT447446	hsa-miR-520d-5p	PAR-CLIP	22100165
MIRT447445	hsa-miR-524-5p	PAR-CLIP	22100165
MIRT438600	hsa-miR-126-3p	Microarray, qRT-PCR	35816043
MIRT769264	hsa-miR-1226	CLIP-seq
MIRT769265	hsa-miR-1238	CLIP-seq
MIRT769266	hsa-miR-23a	CLIP-seq
MIRT769267	hsa-miR-23b	CLIP-seq
MIRT769268	hsa-miR-23c	CLIP-seq
MIRT769269	hsa-miR-25	CLIP-seq
MIRT769270	hsa-miR-26a	CLIP-seq
MIRT769271	hsa-miR-26b	CLIP-seq
MIRT769272	hsa-miR-297	CLIP-seq
MIRT769273	hsa-miR-3186-3p	CLIP-seq
MIRT769274	hsa-miR-32	CLIP-seq
MIRT769275	hsa-miR-3612	CLIP-seq
MIRT769276	hsa-miR-363	CLIP-seq
MIRT769277	hsa-miR-367	CLIP-seq
MIRT769278	hsa-miR-4325	CLIP-seq
MIRT769279	hsa-miR-4532	CLIP-seq
MIRT769280	hsa-miR-4742-3p	CLIP-seq
MIRT769281	hsa-miR-4777-3p	CLIP-seq
MIRT769282	hsa-miR-541	CLIP-seq
MIRT769283	hsa-miR-567	CLIP-seq
MIRT769284	hsa-miR-650	CLIP-seq
MIRT769285	hsa-miR-92a	CLIP-seq
MIRT769286	hsa-miR-92b	CLIP-seq
MIRT1545162	hsa-miR-365	CLIP-seq
MIRT1545163	hsa-miR-374c	CLIP-seq
MIRT1545164	hsa-miR-410	CLIP-seq
MIRT1545165	hsa-miR-4666-3p	CLIP-seq
MIRT1545166	hsa-miR-655	CLIP-seq
MIRT769264	hsa-miR-1226	CLIP-seq
MIRT769275	hsa-miR-3612	CLIP-seq
MIRT1926923	hsa-miR-4449	CLIP-seq
MIRT769279	hsa-miR-4532	CLIP-seq
MIRT769284	hsa-miR-650	CLIP-seq
MIRT769265	hsa-miR-1238	CLIP-seq
MIRT2167797	hsa-miR-181a	CLIP-seq
MIRT2167798	hsa-miR-181b	CLIP-seq
MIRT2167799	hsa-miR-181c	CLIP-seq
MIRT2167800	hsa-miR-181d	CLIP-seq
MIRT769269	hsa-miR-25	CLIP-seq
MIRT769272	hsa-miR-297	CLIP-seq
MIRT769274	hsa-miR-32	CLIP-seq
MIRT769276	hsa-miR-363	CLIP-seq
MIRT769277	hsa-miR-367	CLIP-seq
MIRT2167801	hsa-miR-4262	CLIP-seq
MIRT769278	hsa-miR-4325	CLIP-seq
MIRT2167802	hsa-miR-4329	CLIP-seq
MIRT769280	hsa-miR-4742-3p	CLIP-seq
MIRT769281	hsa-miR-4777-3p	CLIP-seq
MIRT769283	hsa-miR-567	CLIP-seq
MIRT2167803	hsa-miR-720	CLIP-seq
MIRT769285	hsa-miR-92a	CLIP-seq
MIRT769286	hsa-miR-92b	CLIP-seq
MIRT2426057	hsa-miR-1179	CLIP-seq
MIRT2426058	hsa-miR-1237	CLIP-seq
MIRT769265	hsa-miR-1238	CLIP-seq
MIRT2426059	hsa-miR-1248	CLIP-seq
MIRT2167797	hsa-miR-181a	CLIP-seq
MIRT2167798	hsa-miR-181b	CLIP-seq
MIRT2167799	hsa-miR-181c	CLIP-seq
MIRT2167800	hsa-miR-181d	CLIP-seq
MIRT769266	hsa-miR-23a	CLIP-seq
MIRT769267	hsa-miR-23b	CLIP-seq
MIRT769268	hsa-miR-23c	CLIP-seq
MIRT769269	hsa-miR-25	CLIP-seq
MIRT769270	hsa-miR-26a	CLIP-seq
MIRT769271	hsa-miR-26b	CLIP-seq
MIRT769272	hsa-miR-297	CLIP-seq
MIRT2426060	hsa-miR-3065-5p	CLIP-seq
MIRT2426061	hsa-miR-3128	CLIP-seq
MIRT2426062	hsa-miR-3183	CLIP-seq
MIRT769273	hsa-miR-3186-3p	CLIP-seq
MIRT769274	hsa-miR-32	CLIP-seq
MIRT769276	hsa-miR-363	CLIP-seq
MIRT2426063	hsa-miR-3647-5p	CLIP-seq
MIRT1545162	hsa-miR-365	CLIP-seq
MIRT769277	hsa-miR-367	CLIP-seq
MIRT2426064	hsa-miR-3675-3p	CLIP-seq
MIRT2426065	hsa-miR-3692	CLIP-seq
MIRT1545163	hsa-miR-374c	CLIP-seq
MIRT1545164	hsa-miR-410	CLIP-seq
MIRT2167801	hsa-miR-4262	CLIP-seq
MIRT2426066	hsa-miR-4264	CLIP-seq
MIRT2426067	hsa-miR-4265	CLIP-seq
MIRT2426068	hsa-miR-4279	CLIP-seq
MIRT2426069	hsa-miR-4296	CLIP-seq
MIRT2426070	hsa-miR-4310	CLIP-seq
MIRT2426071	hsa-miR-4322	CLIP-seq
MIRT769278	hsa-miR-4325	CLIP-seq
MIRT2426072	hsa-miR-4328	CLIP-seq
MIRT2426073	hsa-miR-4417	CLIP-seq
MIRT2426074	hsa-miR-4459	CLIP-seq
MIRT2426075	hsa-miR-4470	CLIP-seq
MIRT1545165	hsa-miR-4666-3p	CLIP-seq
MIRT2426076	hsa-miR-4723-3p	CLIP-seq
MIRT769280	hsa-miR-4742-3p	CLIP-seq
MIRT2426077	hsa-miR-4753-3p	CLIP-seq
MIRT2426078	hsa-miR-4768-5p	CLIP-seq
MIRT769281	hsa-miR-4777-3p	CLIP-seq
MIRT2426079	hsa-miR-4778-3p	CLIP-seq
MIRT2426080	hsa-miR-4787-5p	CLIP-seq
MIRT2426081	hsa-miR-4789-5p	CLIP-seq
MIRT2426082	hsa-miR-4797-3p	CLIP-seq
MIRT2426083	hsa-miR-4797-5p	CLIP-seq
MIRT2426084	hsa-miR-495	CLIP-seq
MIRT2426085	hsa-miR-539	CLIP-seq
MIRT769282	hsa-miR-541	CLIP-seq
MIRT769283	hsa-miR-567	CLIP-seq
MIRT2426086	hsa-miR-579	CLIP-seq
MIRT2426087	hsa-miR-622	CLIP-seq
MIRT1545166	hsa-miR-655	CLIP-seq
MIRT2426088	hsa-miR-664	CLIP-seq
MIRT769285	hsa-miR-92a	CLIP-seq
MIRT769286	hsa-miR-92b	CLIP-seq
MIRT2426057	hsa-miR-1179	CLIP-seq
MIRT2435220	hsa-miR-1182	CLIP-seq
MIRT769264	hsa-miR-1226	CLIP-seq
MIRT2435221	hsa-miR-1266	CLIP-seq
MIRT2167797	hsa-miR-181a	CLIP-seq
MIRT2167798	hsa-miR-181b	CLIP-seq
MIRT2167799	hsa-miR-181c	CLIP-seq
MIRT2167800	hsa-miR-181d	CLIP-seq
MIRT769266	hsa-miR-23a	CLIP-seq
MIRT769267	hsa-miR-23b	CLIP-seq
MIRT769268	hsa-miR-23c	CLIP-seq
MIRT2435222	hsa-miR-24	CLIP-seq
MIRT2435223	hsa-miR-3173-3p	CLIP-seq
MIRT2435224	hsa-miR-3177-3p	CLIP-seq
MIRT2426062	hsa-miR-3183	CLIP-seq
MIRT2435225	hsa-miR-3184	CLIP-seq
MIRT769273	hsa-miR-3186-3p	CLIP-seq
MIRT769275	hsa-miR-3612	CLIP-seq
MIRT2435226	hsa-miR-361-3p	CLIP-seq
MIRT2435227	hsa-miR-3622a-3p	CLIP-seq
MIRT2435228	hsa-miR-3622b-3p	CLIP-seq
MIRT2435229	hsa-miR-3940-3p	CLIP-seq
MIRT2435230	hsa-miR-3943	CLIP-seq
MIRT2435231	hsa-miR-423-5p	CLIP-seq
MIRT2167801	hsa-miR-4262	CLIP-seq
MIRT2426066	hsa-miR-4264	CLIP-seq
MIRT2426067	hsa-miR-4265	CLIP-seq
MIRT2426068	hsa-miR-4279	CLIP-seq
MIRT2435232	hsa-miR-4284	CLIP-seq
MIRT2435233	hsa-miR-4286	CLIP-seq
MIRT2426069	hsa-miR-4296	CLIP-seq
MIRT2426070	hsa-miR-4310	CLIP-seq
MIRT2426071	hsa-miR-4322	CLIP-seq
MIRT2435234	hsa-miR-4327	CLIP-seq
MIRT2426072	hsa-miR-4328	CLIP-seq
MIRT2426073	hsa-miR-4417	CLIP-seq
MIRT2435235	hsa-miR-4446-3p	CLIP-seq
MIRT1926923	hsa-miR-4449	CLIP-seq
MIRT2435236	hsa-miR-4474-3p	CLIP-seq
MIRT2435237	hsa-miR-4518	CLIP-seq
MIRT2435238	hsa-miR-4521	CLIP-seq
MIRT769279	hsa-miR-4532	CLIP-seq
MIRT2435239	hsa-miR-4649-5p	CLIP-seq
MIRT2435240	hsa-miR-4675	CLIP-seq
MIRT2435241	hsa-miR-4708-3p	CLIP-seq
MIRT2426076	hsa-miR-4723-3p	CLIP-seq
MIRT2435242	hsa-miR-4741	CLIP-seq
MIRT2435243	hsa-miR-4746-5p	CLIP-seq
MIRT2435244	hsa-miR-4779	CLIP-seq
MIRT2426080	hsa-miR-4787-5p	CLIP-seq
MIRT2426082	hsa-miR-4797-3p	CLIP-seq
MIRT2435245	hsa-miR-510	CLIP-seq
MIRT2435246	hsa-miR-518a-5p	CLIP-seq
MIRT2435247	hsa-miR-527	CLIP-seq
MIRT2426085	hsa-miR-539	CLIP-seq
MIRT2426086	hsa-miR-579	CLIP-seq
MIRT769284	hsa-miR-650	CLIP-seq
MIRT2426088	hsa-miR-664	CLIP-seq
MIRT2167797	hsa-miR-181a	CLIP-seq
MIRT2167798	hsa-miR-181b	CLIP-seq
MIRT2167799	hsa-miR-181c	CLIP-seq
MIRT2167800	hsa-miR-181d	CLIP-seq
MIRT2167801	hsa-miR-4262	CLIP-seq
MIRT2426057	hsa-miR-1179	CLIP-seq
MIRT2435220	hsa-miR-1182	CLIP-seq
MIRT2435221	hsa-miR-1266	CLIP-seq
MIRT2435222	hsa-miR-24	CLIP-seq
MIRT2426061	hsa-miR-3128	CLIP-seq
MIRT2470399	hsa-miR-3130-3p	CLIP-seq
MIRT2435223	hsa-miR-3173-3p	CLIP-seq
MIRT2435224	hsa-miR-3177-3p	CLIP-seq
MIRT2470400	hsa-miR-3182	CLIP-seq
MIRT2426062	hsa-miR-3183	CLIP-seq
MIRT2435225	hsa-miR-3184	CLIP-seq
MIRT2470401	hsa-miR-331-3p	CLIP-seq
MIRT2435226	hsa-miR-361-3p	CLIP-seq
MIRT2435227	hsa-miR-3622a-3p	CLIP-seq
MIRT2435228	hsa-miR-3622b-3p	CLIP-seq
MIRT2435229	hsa-miR-3940-3p	CLIP-seq
MIRT2435230	hsa-miR-3943	CLIP-seq
MIRT2435231	hsa-miR-423-5p	CLIP-seq
MIRT2426066	hsa-miR-4264	CLIP-seq
MIRT2426067	hsa-miR-4265	CLIP-seq
MIRT2426068	hsa-miR-4279	CLIP-seq
MIRT2435232	hsa-miR-4284	CLIP-seq
MIRT2470402	hsa-miR-4292	CLIP-seq
MIRT2426069	hsa-miR-4296	CLIP-seq
MIRT2426070	hsa-miR-4310	CLIP-seq
MIRT2470403	hsa-miR-4313	CLIP-seq
MIRT2470404	hsa-miR-4320	CLIP-seq
MIRT2426071	hsa-miR-4322	CLIP-seq
MIRT2426072	hsa-miR-4328	CLIP-seq
MIRT2426073	hsa-miR-4417	CLIP-seq
MIRT2435235	hsa-miR-4446-3p	CLIP-seq
MIRT2426075	hsa-miR-4470	CLIP-seq
MIRT2435236	hsa-miR-4474-3p	CLIP-seq
MIRT2435237	hsa-miR-4518	CLIP-seq
MIRT2435238	hsa-miR-4521	CLIP-seq
MIRT2435239	hsa-miR-4649-5p	CLIP-seq
MIRT2470405	hsa-miR-4659a-3p	CLIP-seq
MIRT2470406	hsa-miR-4659b-3p	CLIP-seq
MIRT2435240	hsa-miR-4675	CLIP-seq
MIRT2435241	hsa-miR-4708-3p	CLIP-seq
MIRT2426076	hsa-miR-4723-3p	CLIP-seq
MIRT2435242	hsa-miR-4741	CLIP-seq
MIRT2435244	hsa-miR-4779	CLIP-seq
MIRT2426080	hsa-miR-4787-5p	CLIP-seq
MIRT2470407	hsa-miR-4793-3p	CLIP-seq
MIRT2426082	hsa-miR-4797-3p	CLIP-seq
MIRT2470408	hsa-miR-486-3p	CLIP-seq
MIRT2435245	hsa-miR-510	CLIP-seq
MIRT2435246	hsa-miR-518a-5p	CLIP-seq
MIRT2435247	hsa-miR-527	CLIP-seq
MIRT2426085	hsa-miR-539	CLIP-seq
MIRT2470409	hsa-miR-544	CLIP-seq
MIRT2426086	hsa-miR-579	CLIP-seq
MIRT2426088	hsa-miR-664	CLIP-seq
MIRT2426057	hsa-miR-1179	CLIP-seq
MIRT2435220	hsa-miR-1182	CLIP-seq
MIRT2435221	hsa-miR-1266	CLIP-seq
MIRT769266	hsa-miR-23a	CLIP-seq
MIRT769267	hsa-miR-23b	CLIP-seq
MIRT769268	hsa-miR-23c	CLIP-seq
MIRT2435222	hsa-miR-24	CLIP-seq
MIRT2426061	hsa-miR-3128	CLIP-seq
MIRT2470399	hsa-miR-3130-3p	CLIP-seq
MIRT2435223	hsa-miR-3173-3p	CLIP-seq
MIRT2435224	hsa-miR-3177-3p	CLIP-seq
MIRT2470400	hsa-miR-3182	CLIP-seq
MIRT2426062	hsa-miR-3183	CLIP-seq
MIRT2435225	hsa-miR-3184	CLIP-seq
MIRT769273	hsa-miR-3186-3p	CLIP-seq
MIRT2470401	hsa-miR-331-3p	CLIP-seq
MIRT2435226	hsa-miR-361-3p	CLIP-seq
MIRT2435227	hsa-miR-3622a-3p	CLIP-seq
MIRT2435228	hsa-miR-3622b-3p	CLIP-seq
MIRT2435230	hsa-miR-3943	CLIP-seq
MIRT2435231	hsa-miR-423-5p	CLIP-seq
MIRT2426066	hsa-miR-4264	CLIP-seq
MIRT2426067	hsa-miR-4265	CLIP-seq
MIRT2426068	hsa-miR-4279	CLIP-seq
MIRT2435232	hsa-miR-4284	CLIP-seq
MIRT2470402	hsa-miR-4292	CLIP-seq
MIRT2426069	hsa-miR-4296	CLIP-seq
MIRT2426070	hsa-miR-4310	CLIP-seq
MIRT2470403	hsa-miR-4313	CLIP-seq
MIRT2470404	hsa-miR-4320	CLIP-seq
MIRT2426071	hsa-miR-4322	CLIP-seq
MIRT2426072	hsa-miR-4328	CLIP-seq
MIRT2426073	hsa-miR-4417	CLIP-seq
MIRT2435235	hsa-miR-4446-3p	CLIP-seq
MIRT2426075	hsa-miR-4470	CLIP-seq
MIRT2435236	hsa-miR-4474-3p	CLIP-seq
MIRT2435237	hsa-miR-4518	CLIP-seq
MIRT2435238	hsa-miR-4521	CLIP-seq
MIRT2435239	hsa-miR-4649-5p	CLIP-seq
MIRT2470405	hsa-miR-4659a-3p	CLIP-seq
MIRT2470406	hsa-miR-4659b-3p	CLIP-seq
MIRT2435240	hsa-miR-4675	CLIP-seq
MIRT2435241	hsa-miR-4708-3p	CLIP-seq
MIRT2426076	hsa-miR-4723-3p	CLIP-seq
MIRT2435242	hsa-miR-4741	CLIP-seq
MIRT2435244	hsa-miR-4779	CLIP-seq
MIRT2426080	hsa-miR-4787-5p	CLIP-seq
MIRT2470407	hsa-miR-4793-3p	CLIP-seq
MIRT2426082	hsa-miR-4797-3p	CLIP-seq
MIRT2470408	hsa-miR-486-3p	CLIP-seq
MIRT2435245	hsa-miR-510	CLIP-seq
MIRT2435246	hsa-miR-518a-5p	CLIP-seq
MIRT2435247	hsa-miR-527	CLIP-seq
MIRT2426085	hsa-miR-539	CLIP-seq
MIRT2470409	hsa-miR-544	CLIP-seq
MIRT2426086	hsa-miR-579	CLIP-seq
MIRT2426088	hsa-miR-664	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
CEBPB	Activation	9480831
CEBPB	Unknown	12630823
GTF3A	Unknown	12630823
TFAP2A	Unknown	10848972

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001570	Process	Vasculogenesis	IDA	16964401
GO:0001843	Process	Neural tube closure	IEA
GO:0001878	Process	Response to yeast	IDA	10225288
GO:0002031	Process	G protein-coupled receptor internalization	IDA	10882736
GO:0003073	Process	Regulation of systemic arterial blood pressure	IBA
GO:0003073	Process	Regulation of systemic arterial blood pressure	IDA	18434369
GO:0005102	Function	Signaling receptor binding	TAS	8524787
GO:0005179	Function	Hormone activity	IDA	32296767
GO:0005179	Function	Hormone activity	IEA
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	10225288, 12379507
GO:0005615	Component	Extracellular space	IEA
GO:0005737	Component	Cytoplasm	IDA	12379507
GO:0006954	Process	Inflammatory response	TAS	8524787
GO:0007165	Process	Signal transduction	TAS	10822232
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IBA
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IDA	17110384, 32296767
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IDA	10882736, 18434369, 20074556
GO:0007507	Process	Heart development	IEA
GO:0008283	Process	Cell population proliferation	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0010460	Process	Positive regulation of heart rate	IBA
GO:0010460	Process	Positive regulation of heart rate	IDA	18434369
GO:0019731	Process	Antibacterial humoral response	IDA	10225288
GO:0019732	Process	Antifungal humoral response	IDA	10225288
GO:0031623	Process	Receptor internalization	IDA	10882736, 15613468, 20074556
GO:0031700	Function	Adrenomedullin receptor binding	IBA
GO:0031700	Function	Adrenomedullin receptor binding	IDA	20074556
GO:0034774	Component	Secretory granule lumen	TAS
GO:0035809	Process	Regulation of urine volume	IDA	18434369
GO:0043116	Process	Negative regulation of vascular permeability	IEA
GO:0045766	Process	Positive regulation of angiogenesis	IEA
GO:0045906	Process	Negative regulation of vasoconstriction	IDA	11410113
GO:0048018	Function	Receptor ligand activity	IEA
GO:0048589	Process	Developmental growth	IEA
GO:0050829	Process	Defense response to Gram-negative bacterium	IDA	10225288
GO:0050830	Process	Defense response to Gram-positive bacterium	IDA	10225288
GO:0060670	Process	Branching involved in labyrinthine layer morphogenesis	IEA
GO:0061844	Process	Antimicrobial humoral immune response mediated by antimicrobial peptide	IDA	10225288
GO:0097084	Process	Vascular associated smooth muscle cell development	IEA
GO:0097646	Process	Calcitonin family receptor signaling pathway	IEA
GO:1990410	Process	Adrenomedullin receptor signaling pathway	IBA
GO:1990410	Process	Adrenomedullin receptor signaling pathway	IDA	32296767
GO:1990410	Process	Adrenomedullin receptor signaling pathway	IDA	10882736, 18434369, 20074556, 32296767
GO:2000184	Process	Positive regulation of progesterone biosynthetic process	TAS	10822232
GO:2001214	Process	Positive regulation of vasculogenesis	IEA

Other IDs

• MIM: 103275
• HGNC: 259
• e!Ensembl: ENSG00000148926

Protein

• UniProt ID: P35318
• Protein name: Pro-adrenomedullin [Cleaved into: Adrenomedullin (AM); Proadrenomedullin N-20 terminal peptide (ProAM N-terminal 20 peptide) (PAMP) (ProAM-N20)]
• Protein function: Adrenomedullin/ADM and proadrenomedullin N-20 terminal peptide/PAMP are peptide hormones that act as potent hypotensive and vasodilatator agents (PubMed:8387282, PubMed:9620797). Numerous actions have been reported most related to the physiologi
• PDB: 2FLY, 2L7S, 4RWF, 5V6Y, 6UUN, 6UUS, 6V2E, 7VV0
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00214	Calc_CGRP_IAPP	1 → 151	Calcitonin / CGRP / IAPP family	Family

• Tissue specificity: TISSUE SPECIFICITY: Highest levels found in pheochromocytoma and adrenal medulla. Also found in lung, ventricle and kidney tissues. {ECO:0000269|PubMed:8387282}.
• Sequence:

  MKLVSVALMYLGSLAFLGADTARLDVASEFRKKWNKWALSRGKRELRMSSSYPTGLADVK
  AGPAQTLIRPQDMKGASRSPEDSSPDAARIRVKRYRQSMNNFQGLRSFGCRFGTCTVQKL
  AHQIYQFTDKDKDNVAPRSKISPQGYGRRRRRSLPEAGPGRTLVSSKPQAHGAPAPPSGS
  APHFL

• Sequence length: 185

Pathways

KEGG:

Neuroactive ligand-receptor interaction
Vascular smooth muscle contraction

Reactome:

G alpha (s) signalling events
Calcitonin-like ligand receptors
ADORA2B mediated anti-inflammatory cytokines production

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
AUTISTIC DISORDER	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN INFARCTION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTRIC ULCER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLOMERULONEPHRITIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERALGESIA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERGLYCEMIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSULIN RESISTANCE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POLYCYSTIC OVARY SYNDROME	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEPSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute leukemia	Leukemia	BEFREE	25879330		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	30250620		★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	31322275		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	17363587, 21839130		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	22923200		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	17290391		★☆☆☆☆ Found in Text Mining only
Adrenal Cortical Adenoma	Adrenocortical adenoma	LHGDN	11712085		★☆☆☆☆ Found in Text Mining only
Adrenal Cortical Adenoma	Adrenocortical adenoma	BEFREE	9487993		★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	10795919, 10848972, 11032871, 11318031, 11747138, 11921351, 12441221, 15206165, 16112409, 16153719, 16616959, 16769769, 17100569, 17102095, 17952853, 20483910, 21046451, 22923200, 23715749, 23741410, 26791747, 26923268, 28150464, 29153200, 30592365, 7649118, 7688224, 8074714, 9003063, 9487993, 9578513, 9788655		★☆☆☆☆ Found in Text Mining only
Adrenocortical carcinoma	Adrenocortical carcinoma	BEFREE	11078430, 15702240		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	30250620		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	10764880, 22841816, 28866675		★☆☆☆☆ Found in Text Mining only
Amnesia	Amnesia	BEFREE	29187812, 31449828		★☆☆☆☆ Found in Text Mining only
Anaplastic astrocytoma	Anaplastic Astrocytoma	BEFREE	11943713, 9396051		★☆☆☆☆ Found in Text Mining only
Angina Unstable	Angina pectoris	Pubtator	15367525	Stimulate	★☆☆☆☆ Found in Text Mining only
Angina, Unstable	Intermediate coronary syndrome	BEFREE	15367525		★☆☆☆☆ Found in Text Mining only
Angioedemas Hereditary	Angioedema	Pubtator	29729940	Stimulate	★☆☆☆☆ Found in Text Mining only
Angioedemas, Hereditary	Angioedema	BEFREE	29729940		★☆☆☆☆ Found in Text Mining only
Angle Closure Glaucoma	Angle Closure Glaucoma	BEFREE	17608625		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	17290391, 27391260		★☆☆☆☆ Found in Text Mining only
Anorexia	Anorexia	BEFREE	30396073		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	30020987		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	30020987		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	28766358		★☆☆☆☆ Found in Text Mining only
Appendicitis	Appendicitis	BEFREE	30287129		★☆☆☆☆ Found in Text Mining only
Arterial Occlusive Diseases	Arterial Occlusive Disease	LHGDN	14759562		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	10826560, 15367525, 16141406, 16616959, 25053723		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	20942979	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	37470226	Stimulate	★☆☆☆☆ Found in Text Mining only
Asphyxia Neonatorum	Postnatal asphyxia	BEFREE	12444904		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	22686590, 30690080		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	11943713, 25246098		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	25246098	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	10826560, 15367525, 16141406, 25053723		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	15367525, 19247278	Associate	★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	27609943, 31808279		★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	28670953		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	CTD_human_DG	12579522		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Diseases	Autoimmune Diseases	BEFREE	26079624		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	26035796, 29179449		★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	11221851		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	15194870, 20713499, 23064081		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar disorder	Pubtator	20713499	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar II disorder	Bipolar Disorder	BEFREE	20713499		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	23715749, 25337195, 28742207		★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	17900349	Associate	★☆☆☆☆ Found in Text Mining only
Bone Marrow Diseases	Bone Marrow Diseases	BEFREE	28514903		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	9396051		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	11973640, 12189226, 12560435, 14612905, 19502811, 22484497, 22717413, 23936147, 25439669, 25867381, 28178651, 29257222, 29337108, 30127988		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	14612905, 32819314, 37174704	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	25246098	Stimulate	★☆☆☆☆ Found in Text Mining only
Bright Disease	Bright Disease	CTD_human_DG	15063164, 15680492		★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary dysplasia	Pubtator	32412065	Associate	★☆☆☆☆ Found in Text Mining only
Capillary Leak Syndrome	Capillary leak syndrome	Pubtator	29360169	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	14747444, 36827885	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	11828944, 15547717, 7649118, 9487993		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	27918554, 36827885, 38320622	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	23715749, 25337195, 28742207		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	25246098, 25879330		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	22400488, 26098087, 28091613	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	12110091	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	23969937	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Neuroendocrine	Carcinoma	BEFREE	16633328		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	11006313, 19616043, 22294191, 22400488, 22859951, 26098087, 28091613		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	27823982		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	11087213	Stimulate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	15539129, 23283493		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	10386225, 11254908, 11305974, 11352835, 11921351, 12630823, 15269340, 15808915, 16616959, 18097473, 23088295, 25053723, 28050899, 29689347, 30481494, 30540625		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	LHGDN	17053041		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	23936408, 38014560	Associate	★☆☆☆☆ Found in Text Mining only
CATARACT, ANTERIOR POLAR	Cataract	BEFREE	29161297		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	15684700, 25252154		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	35962388	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Palsy	Cerebral palsy	BEFREE	17290391		★☆☆☆☆ Found in Text Mining only
Cerebral Vasospasm	Cerebral Vasospasm	BEFREE	28684727		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	LHGDN	15361766		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	16384868, 21695352, 23968191, 26542692, 28904253, 31439414		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	24037526		★☆☆☆☆ Found in Text Mining only
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	11828944		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	24037526		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	30250620		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	26043778	Associate	★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	11502838, 12444904, 15917349		★☆☆☆☆ Found in Text Mining only
Choroid Plexus Carcinoma	Choroid Plexus Carcinoma	BEFREE	9003063		★☆☆☆☆ Found in Text Mining only
Chronic heart failure	Heart Failure	BEFREE	24531032		★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	25948679, 30536342		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	12877796		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	LHGDN	14720432		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	21350119, 30306504		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	Pubtator	33132326	Inhibit	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	22923200, 24519534, 29235493		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	24519534		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	21378331, 21839130, 23634287, 24519534		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	21839130, 23634287		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	23922913	Associate	★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	11305974, 11972292, 15464589, 15539129, 16616959, 24531032, 25868038, 26766169, 28212715, 28606358, 28689178, 29138835, 29153200, 29577955, 30232509, 30481494, 30592365, 30843353, 31797505		★☆☆☆☆ Found in Text Mining only
Conn Adenoma	Conn Adenoma	BEFREE	11712085		★☆☆☆☆ Found in Text Mining only
Connective Tissue Diseases	Connective Tissue Disease	BEFREE	19565506		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	19610056, 23969937, 27556517		★☆☆☆☆ Found in Text Mining only
Coronary Aneurysm	Coronary aneurysm	Pubtator	15367525	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	19623513, 20691218		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	17878224, 19623513, 20691218		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	35263363	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	19247278	Associate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	19623513, 20691218		★☆☆☆☆ Found in Text Mining only
Cyclical vomiting syndrome (disorder)	Cyclical Vomiting Syndrome	BEFREE	28684727		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	12709825, 16622024, 19210874, 24556692		★☆☆☆☆ Found in Text Mining only
Dementia, Vascular	Dementia	BEFREE	29600350, 31449828		★☆☆☆☆ Found in Text Mining only
Dental Caries	Dental caries	Pubtator	15869869	Associate	★☆☆☆☆ Found in Text Mining only
Dentatorubral-Pallidoluysian Atrophy	Dentatorubral Pallidoluysian Atrophy	BEFREE	28544540		★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	23064081	Associate	★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	30020987		★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	22445417		★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	Pubtator	35720354	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	10609119, 10698123, 12667633, 17100569, 22960655, 25287126, 29192743		★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	28666334	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	30020508, 30383252, 35390031	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	10609119, 10698123, 11747138, 12667633, 17100569, 22960655, 25287126, 29192743		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	23936408, 25287126, 28666334	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	31479091	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	35534828, 37117225	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	12753312, 19247278	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	10609119, 14717924, 25092567		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	10698123, 12667633, 12753312, 25948679, 30232509		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	LHGDN	12716843, 12753312		★☆☆☆☆ Found in Text Mining only
Diabetic Angiopathies	Diabetic cardiomyopathy	LHGDN	17384335		★☆☆☆☆ Found in Text Mining only
Diabetic Angiopathies	Diabetic cardiomyopathy	BEFREE	25287126		★☆☆☆☆ Found in Text Mining only
Diabetic Ketoacidosis	Diabetic Ketoacidosis	BEFREE	10609119		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	LHGDN	12630823		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	14717924, 16616959, 25948679		★☆☆☆☆ Found in Text Mining only
Disorder of eye	Disorder Of Eye	BEFREE	11318031, 28322199		★☆☆☆☆ Found in Text Mining only
Eclampsia	Eclampsia	BEFREE	10421805, 16517613		★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	22445417		★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	BEFREE	14499284, 31439414		★☆☆☆☆ Found in Text Mining only
Endocrine System Diseases	Endocrine System Diseases	BEFREE	15206165		★☆☆☆☆ Found in Text Mining only
Endometrial adenocarcinoma	Endometrial Adenocarcinoma	BEFREE	23969937		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	11420706, 11973640, 22178239		★☆☆☆☆ Found in Text Mining only
Endometrial Hyperplasia	Endometrial Hyperplasia	BEFREE	11973640, 24927229		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial Neoplasms	BEFREE	11973640		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	23969937	Stimulate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	27491770, 29871794	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	29871794		★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	11006313, 22400488, 28091613		★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	11463752, 16097366, 22932875, 24147025		★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	Pubtator	24147025	Associate	★☆☆☆☆ Found in Text Mining only
Frontotemporal Lobar Degeneration	Frontotemporal dementia	BEFREE	29671277		★☆☆☆☆ Found in Text Mining only
Gastric ulcer	Gastric ulcer	CTD_human_DG	9845272		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastrointestinal Neoplasms	Gastrointestinal Neoplasms	BEFREE	22923200		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	11032871, 11943713, 14499284, 19166930, 21458987, 24457964, 9396051		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	11032871, 24457964, 35456975	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	11032871, 11943713, 14499284, 19166930, 21458987, 24457964, 9396051		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	14747444, 25246098	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	25246098, 9396051		★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	CTD_human_DG	15063164, 15680492		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glomerulonephritis	Glomerulonephritis	BEFREE	15619030		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glomerulosclerosis (disorder)	Glomerulosclerosis	BEFREE	10986555, 11352835		★☆☆☆☆ Found in Text Mining only
Glycogen storage disease type II	Glycogen Storage Disease	BEFREE	28866675		★☆☆☆☆ Found in Text Mining only
Gout	Gout	Pubtator	35116032	Associate	★☆☆☆☆ Found in Text Mining only
granulosa cell tumor	Granulosa Cell Tumor	BEFREE	19253104		★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	15539129, 24531032, 30166452		★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	11087213, 25868038, 37140510, 9241097	Associate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	11305974, 11972292, 15539129, 16616959, 25868038, 26766169, 28212715, 28606358, 28689178, 29138835, 29153200, 29577955, 30592365, 30843353, 31797505		★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	LHGDN	11972292, 15974887		★☆☆☆☆ Found in Text Mining only
Heart Failure Diastolic	Heart failure	Pubtator	34685778	Associate	★☆☆☆☆ Found in Text Mining only
HELLP Syndrome	HELLP Syndrome	LHGDN	11905404		★☆☆☆☆ Found in Text Mining only
Hepatorenal Syndrome	Hepatorenal Syndrome	BEFREE	28544540		★☆☆☆☆ Found in Text Mining only
Hidradenitis Suppurativa	Hidradenitis suppurativa	BEFREE	31688984		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	30536342		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington disease	Pubtator	12753312	Associate	★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	30536342		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	12424108		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperlipidemia	Hyperlipidemia	BEFREE	16097366, 30020508		★☆☆☆☆ Found in Text Mining only
Hyperlipidemias	Hyperlipidemia	Pubtator	30020508	Associate	★☆☆☆☆ Found in Text Mining only
Hyperoxia	Hyperoxia	Pubtator	26196743	Associate	★☆☆☆☆ Found in Text Mining only
Hyperoxia	Hyperoxia	Pubtator	34911614	Stimulate	★☆☆☆☆ Found in Text Mining only
Hyperparathyroidism, Primary	Hyperparathyroidism	LHGDN	12601625		★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	11087213	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	19247278, 19424162, 23356193, 31048758, 35205232	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension, Renovascular	Hypertension	BEFREE	11352835		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	10826560, 10986555, 11116114, 11463752, 11754958, 12835224, 15797661, 15808915, 16097366, 16616959, 20798523, 22932875, 24147025, 27108271, 27614623, 28653133, 29028080, 30276527, 30536406, 30540625, 31048758, 31205027, 31328309, 31466304		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	LHGDN	12630823, 16097366		★☆☆☆☆ Found in Text Mining only
Hypotension	Hypotension	Pubtator	12753312, 29360169	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	11032871, 12110091, 12963716, 18050204, 18508787, 24523299, 34942165, 35532553	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	12885785, 14612905, 16474185, 17020966, 22859951, 24114211, 24457964, 29966011, 32819314, 34637697, 36140669	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxic-Ischemic Encephalopathy	Hypoxic-Ischemic Encephalopathy	BEFREE	12444904		★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	10867534, 15902095		★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	LHGDN	15902095		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	28234256, 29187812		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	29311984		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	33132326, 36643579	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Breast Carcinoma	Breast Cancer	BEFREE	30476929		★☆☆☆☆ Found in Text Mining only
insulinoma	Insulinoma	BEFREE	12667633		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	21695352, 23968191		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	10986555, 11116114, 11921351, 12424108, 12753312, 17100569, 24505304, 25948679, 28528353		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	12753312	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure	Kidney Failure	BEFREE	12753312, 15797661, 16616959		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	28110613, 28544540		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	25948679, 30536342		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasm	Kidney Neoplasm	BEFREE	19610056		★☆☆☆☆ Found in Text Mining only
Learning Disorders	Learning Disorders	BEFREE	31449828		★☆☆☆☆ Found in Text Mining only
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	BEFREE	29411326		★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	34942165	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	24375249, 31818729, 33538241, 40557150	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	30395908	Inhibit	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	30779089, 31322275, 9558371		★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	BEFREE	26932183		★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	25029526		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	18657357		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	19951584, 23583388, 24927229, 25473899, 27918554, 29137246, 29191453, 29337108		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	25473899, 29337108		★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	35720354	Associate	★☆☆☆☆ Found in Text Mining only
Lung Diseases, Interstitial	Lung Diseases	BEFREE	19565506		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	7649118		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	30183598	Inhibit	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	11422212, 30183598		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	11422212		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	14612905	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	25879330		★☆☆☆☆ Found in Text Mining only
Malignant Hypertension	Malignant Hypertension	BEFREE	12105147		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	11973640, 12189226, 14612905, 19502811, 22484497, 22717413, 23936147, 25439669, 25867381, 26392082, 29257222, 29337108, 30127988		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	11420706, 22178239		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	25246098, 25879330		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	25029526		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	22294191, 22400488, 22859951		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	12606950, 17363587, 22960655, 27246849, 29192743		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	11221851, 12581889, 15336545, 17100569, 17637748, 19010904, 29949147		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	22923200, 29179449, 30305610		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	23715749, 25337195, 28742207		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11973640, 12189226, 12581889, 14612905, 16769769, 17100569, 20004564, 21378331, 21839130, 22859951, 22993405, 23450059, 23741410, 23969937, 24037526, 24927229, 25246098, 25879330, 26035796, 29048889, 8798536		★☆☆☆☆ Found in Text Mining only
Malignant Peripheral Nerve Sheath Tumor	Malignant Peripheral Nerve Sheath Tumor	BEFREE	20739432		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	24037526		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	22923200, 24519534, 29235493		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	12189226, 14612905		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	14612905		★☆☆☆☆ Found in Text Mining only
Medullary Neoplasms	Medullary Neoplasms	BEFREE	9487993		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	27921338, 30020987		★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	28670953		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	26762744		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	16793965		★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	BEFREE	26923268		★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood disorder	Pubtator	23064081	Associate	★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	25029526	Associate	★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	BEFREE	15531734		★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	LHGDN	15531734		★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	36042431, 36829193	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	22819074, 23478664, 26045737		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	30897575		★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Duchenne	Duchenne Muscular Dystrophy	BEFREE	23283493		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	BEFREE	2575610, 3481435		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	11087213, 17878224	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	12805025, 15684700, 16616959, 28348718, 29890546, 30166452, 30582443		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	LHGDN	12805025		★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	11318031		★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	12753312	Associate	★☆☆☆☆ Found in Text Mining only
Nasal Type Extranodal NK/T-Cell Lymphoma	Extranodal NK T Cell Lymphoma	BEFREE	30302057		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10678554, 10764880, 10847587, 11004664, 11006313, 11221851, 11420706, 11943713, 11973640, 12189226, 12441221, 12560435, 12581889, 12606950, 14612905, 15336545, 15547717, 15930287, 17637748, 19010904, 19610056, 19616043, 21458987, 22178239, 22294191, 22400488, 22993405, 23099649, 23393227, 23634287, 23715749, 23936147, 23969937, 24927229, 25439669, 26762744, 27272776, 27391260, 27556517, 28091613, 29179449, 29235493, 29904904, 31150417, 31754214, 8798536, 9003063, 9396051, 9487993, 9578513		★☆☆☆☆ Found in Text Mining only
Neoplasms, Intracranial	Intracranial Neoplasm	BEFREE	11489141		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	11004664, 15677761, 29290991		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	9303556	Inhibit	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	26923268, 29600350		★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 1	Neurofibromatosis	BEFREE	20739432		★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 1	Neurofibromatosis	Pubtator	20739432	Stimulate	★☆☆☆☆ Found in Text Mining only
Neurofibrosarcoma	Neurofibrosarcoma	Pubtator	20739432	Stimulate	★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	29048889		★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	BEFREE	26932183		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	29785003		★☆☆☆☆ Found in Text Mining only
Non-Functioning Pituitary Gland Neoplasm	Pituitary adenoma	BEFREE	17952853		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	12168820		★☆☆☆☆ Found in Text Mining only
NONAKA MYOPATHY	Inclusion body myopathy	BEFREE	15677761		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	10609119, 15315911, 17327422, 17433499, 29411326		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	19247278, 38014560	Associate	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	34231954	Stimulate	★☆☆☆☆ Found in Text Mining only
Oculocutaneous albinism type 1A	Oculocutaneous albinism	BEFREE	28544540		★☆☆☆☆ Found in Text Mining only
oligodendroglioma	Oligodendroglioma	BEFREE	11943713		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	36799242	Inhibit	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	37962028	Associate	★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	23329517, 29568943	Associate	★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	29067096		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	25879330, 26035796, 30890367		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	25879330	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	22400488		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	12969589		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	22294191, 22859951		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	22400488, 22859951	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	12606950, 17363587, 22960655, 27246849, 29192743		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	27391260		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	17290391		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	37117225	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	BEFREE	17290391		★☆☆☆☆ Found in Text Mining only
Papilloma Choroid Plexus	Choroid plexus papilloma	Pubtator	9003063	Associate	★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal disease	Pubtator	18435806	Associate	★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	BEFREE	29676776, 30485856		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	29676776		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	38241313	Associate	★☆☆☆☆ Found in Text Mining only
Peripheral Vascular Diseases	Vascular Diseases	BEFREE	25287126		★☆☆☆☆ Found in Text Mining only
Peripheral Vascular Diseases	Peripheral vascular disease	Pubtator	25287126	Associate	★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	Pubtator	10617110, 10848972, 11032871, 9003063	Associate	★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	BEFREE	10795919, 10848972, 11032871, 11318031, 11747138, 11921351, 12441221, 15206165, 16112409, 16153719, 16616959, 16769769, 17100569, 17102095, 17952853, 20483910, 21046451, 22923200, 23715749, 23741410, 26791747, 26923268, 28150464, 29153200, 30592365, 7649118, 7688224, 8074714, 9003063, 9487993, 9578513, 9788655		★☆☆☆☆ Found in Text Mining only
PIGMENTARY DISORDER, RETICULATE, WITH SYSTEMIC MANIFESTATIONS	Pigmentary Disorder, Reticulate, With Systemic Manifestations	BEFREE	28272719		★☆☆☆☆ Found in Text Mining only
Pilocytic Astrocytoma	Astrocytoma	BEFREE	21458987		★☆☆☆☆ Found in Text Mining only
Plexiform Neurofibroma	Plexiform neurofibroma	BEFREE	20739432		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	27424881, 29295870		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Polycythemia primary familial and congenital	Polycythemia, primary familial and congenital	Pubtator	18508787	Associate	★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	25053723, 30371151		★☆☆☆☆ Found in Text Mining only
Proliferative diabetic retinopathy	Proliferative Diabetic Retinopathy	BEFREE	10764880, 28272719		★☆☆☆☆ Found in Text Mining only
Proliferative vitreoretinopathy	Proliferative Vitreoretinopathy	BEFREE	10764880		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	11221851, 12581889, 12949839, 15336545, 15609296, 17100569, 17637748, 19010904, 29949147		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	15336545, 19010904		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	15336545	Inhibit	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	15609296, 19010904		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	16297990, 29949147	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	28408815, 35263363	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	23585227		★☆☆☆☆ Found in Text Mining only
Pyelonephritis	Pyelonephritis	LHGDN	16221100		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	27556517		★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	18401334		★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	12424108, 15464589, 28110613		★☆☆☆☆ Found in Text Mining only
Respiratory Failure	Respiratory Failure	BEFREE	31238370		★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	28322199		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	12709825, 16622024, 19210874, 20697789, 23711352, 24556692		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	15194870, 18081029, 27776076		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	LHGDN	15194870, 18081029		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	15194870, 18081029		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Septicemia	Septicemia	BEFREE	10777702, 12643861, 15464589, 15930287, 17053041, 19009024, 27865148, 28411114, 29246418, 29246637, 29324626, 29324627, 29413717, 29520277, 29856470, 30207133, 30583748, 30592365, 30782906, 30822437, 31037864, 31625979		★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	CTD_human_DG	14766677		★☆☆☆☆ Found in Text Mining only
Sex Cord-Stromal Tumor	Sex Cord-Stromal Tumor	BEFREE	19253104		★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	22445417		★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	BEFREE	9389548		★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	33879148	Associate	★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	16633328		★☆☆☆☆ Found in Text Mining only
Spinal Cord Diseases	Spinal Cord Diseases	BEFREE	28514903		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	11828944, 12720100		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	12720100		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	38256104	Associate	★☆☆☆☆ Found in Text Mining only
Stable angina	Stable Angina	BEFREE	15367525		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	22923200, 29179449, 30305610		★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	28904253	Associate	★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	28684727		★☆☆☆☆ Found in Text Mining only
Subfertility	Subfertility	BEFREE	29025060		★☆☆☆☆ Found in Text Mining only
Telangiectasia Hereditary Hemorrhagic	Hereditary hemorrhagic telangiectasia	Pubtator	33888392	Associate	★☆☆☆☆ Found in Text Mining only
Thrombocythemia, Essential	Thrombocythemia	BEFREE	28259616		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	35528004	Associate	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	29311984, 30306504		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	23183654, 28742207	Associate	★☆☆☆☆ Found in Text Mining only
Uveitis	Uveitis	LHGDN	12383875		★☆☆☆☆ Found in Text Mining only
Varicosity	Vulval varices	BEFREE	10795919		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	11254908, 16141406, 17065400, 25287126, 28324104		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	23356193, 25287126	Associate	★☆☆☆☆ Found in Text Mining only
Ventricular Fibrillation	Ventricular fibrillation	Pubtator	19424162	Associate	★☆☆☆☆ Found in Text Mining only
Well Differentiated Oligodendroglioma	Oligodendroglioma	BEFREE	11943713		★☆☆☆☆ Found in Text Mining only