Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	1329
Gene name	Cytochrome c oxidase subunit 5B
Gene symbol	COX5B
Synonyms (NCBI Gene)	COXVB
Chromosome	2
Chromosome location	2q11.2
Summary	Cytochrome C oxidase (COX) is the terminal enzyme of the mitochondrial respiratory chain. It is a multi-subunit enzyme complex that couples the transfer of electrons from cytochrome c to molecular oxygen and contributes to a proton electrochemical gradien

Show/Hide all (40)

miRTarBase ID	miRNA	Experiments	Reference
MIRT564388	hsa-miR-3120-3p	PAR-CLIP	20371350
MIRT564387	hsa-miR-6869-5p	PAR-CLIP	20371350
MIRT564386	hsa-miR-8081	PAR-CLIP	20371350
MIRT207609	hsa-miR-8055	PAR-CLIP	20371350
MIRT564388	hsa-miR-3120-3p	PAR-CLIP	20371350
MIRT564387	hsa-miR-6869-5p	PAR-CLIP	20371350
MIRT564386	hsa-miR-8081	PAR-CLIP	20371350
MIRT207609	hsa-miR-8055	PAR-CLIP	20371350
MIRT905399	hsa-miR-1243	CLIP-seq
MIRT905400	hsa-miR-130a	CLIP-seq
MIRT905401	hsa-miR-130b	CLIP-seq
MIRT905402	hsa-miR-301a	CLIP-seq
MIRT905403	hsa-miR-301b	CLIP-seq
MIRT905404	hsa-miR-3591-5p	CLIP-seq
MIRT905405	hsa-miR-3654	CLIP-seq
MIRT905406	hsa-miR-3666	CLIP-seq
MIRT905407	hsa-miR-3978	CLIP-seq
MIRT905408	hsa-miR-4295	CLIP-seq
MIRT905409	hsa-miR-4434	CLIP-seq
MIRT905410	hsa-miR-4473	CLIP-seq
MIRT905411	hsa-miR-4516	CLIP-seq
MIRT905412	hsa-miR-454	CLIP-seq
MIRT905413	hsa-miR-4671-3p	CLIP-seq
MIRT905414	hsa-miR-875-3p	CLIP-seq
MIRT905399	hsa-miR-1243	CLIP-seq
MIRT905400	hsa-miR-130a	CLIP-seq
MIRT905401	hsa-miR-130b	CLIP-seq
MIRT905402	hsa-miR-301a	CLIP-seq
MIRT905403	hsa-miR-301b	CLIP-seq
MIRT905404	hsa-miR-3591-5p	CLIP-seq
MIRT905405	hsa-miR-3654	CLIP-seq
MIRT905406	hsa-miR-3666	CLIP-seq
MIRT905407	hsa-miR-3978	CLIP-seq
MIRT905408	hsa-miR-4295	CLIP-seq
MIRT905409	hsa-miR-4434	CLIP-seq
MIRT905410	hsa-miR-4473	CLIP-seq
MIRT905411	hsa-miR-4516	CLIP-seq
MIRT905412	hsa-miR-454	CLIP-seq
MIRT905413	hsa-miR-4671-3p	CLIP-seq
MIRT905414	hsa-miR-875-3p	CLIP-seq

Show/Hide all (20)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004129	Function	Cytochrome-c oxidase activity	TAS	1646156
GO:0005515	Function	Protein binding	IPI	17500595, 21516116, 25416956, 31170524, 31515488, 32296183, 32814053, 34446781
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IBA
GO:0005739	Component	Mitochondrion	IDA
GO:0005739	Component	Mitochondrion	IEA
GO:0005740	Component	Mitochondrial envelope	IEA
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005743	Component	Mitochondrial inner membrane	TAS
GO:0006119	Process	Oxidative phosphorylation	IEA
GO:0006123	Process	Mitochondrial electron transport, cytochrome c to oxygen	IBA
GO:0006123	Process	Mitochondrial electron transport, cytochrome c to oxygen	IEA
GO:0006123	Process	Mitochondrial electron transport, cytochrome c to oxygen	NAS	30030519
GO:0007585	Process	Respiratory gaseous exchange by respiratory system	TAS	1646156
GO:0016020	Component	Membrane	IEA
GO:0031966	Component	Mitochondrial membrane	IDA	30030519
GO:0045277	Component	Respiratory chain complex IV	IEA
GO:0045333	Process	Cellular respiration	NAS	30030519
GO:0046872	Function	Metal ion binding	IEA
GO:1902600	Process	Proton transmembrane transport	IEA

MIM	HGNC	e!Ensembl
123866	2269	ENSG00000135940

P10606

Protein name

Cytochrome c oxidase subunit 5B, mitochondrial (Cytochrome c oxidase polypeptide Vb)

Protein function

Component of the cytochrome c oxidase, the last enzyme in the mitochondrial electron transport chain which drives oxidative phosphorylation. The respiratory chain contains 3 multisubunit complexes succinate dehydrogenase (complex II, CII), ubiqu

PDB

5Z62

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01215	COX5B	8 → 128	Cytochrome c oxidase subunit Vb	Domain

Sequence

MASRLLRGAGTLAAQALRARGPSGAAAMRSMASGGGVPTDEEQATGLEREIMLAAKKGLD
PYNVLAPKGASGTREDPNLVPSISNKRIVGCICEEDNTSVVWFWLHKGEAQRCPRCGAHY
KLVPQQLAH

Sequence length

129

Interactions

View interactions

	KEGG		Reactome
	Oxidative phosphorylation Metabolic pathways Cardiac muscle contraction Thermogenesis Non-alcoholic fatty liver disease Alzheimer disease Parkinson disease Amyotrophic lateral sclerosis Huntington disease Prion disease Pathways of neurodegeneration - multiple diseases Chemical carcinogenesis - reactive oxygen species Diabetic cardiomyopathy		TP53 Regulates Metabolic Genes Respiratory electron transport

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
MYOCARDIAL ISCHEMIA	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (23)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Breast Carcinoma	Breast Carcinoma	BEFREE	28592145		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	37510369	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bulbo-Spinal Atrophy, X-Linked	Bulbospinal Atrophy, X-Linked	BEFREE	11719263		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	27383302		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	10915781, 28628609	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	31280487		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive Disorder Major	Major depressive disorder	Pubtator	35821008	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	22095239		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatigue Syndrome Chronic	Fatigue syndrome	Pubtator	18596870	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	29180880		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	29180880		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	29180880		★★★★★ ★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	28592145		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	28592145		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	27383302		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	29107073		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	36551283	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	CTD_human_DG	16214533		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neoplasms	Neoplasms	BEFREE	25027580, 29180880		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	27383302		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	27383302, 34439877	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	28246552		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	29107073		★★★★★ ★☆☆☆☆ Found in Text Mining only

COX5B (cytochrome c oxidase subunit 5B)