Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	132671
Gene name	Spermatogenesis associated 18
Gene symbol	SPATA18
Synonyms (NCBI Gene)	MieapSPETEX1
Chromosome	4
Chromosome location	4q12
Summary	This gene encodes a p53-inducible protein that is able to induce lysosome-like organelles within mitochondria that eliminate oxidized mitochondrial proteins, thereby contributing to mitochondrial quality control. Dysregulation of mitochondrial quality con

197

Show/Hide all (197)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017774	hsa-miR-335-5p	Microarray	18185580
MIRT545174	hsa-miR-6888-5p	PAR-CLIP	21572407
MIRT545172	hsa-miR-3938	PAR-CLIP	21572407
MIRT545171	hsa-miR-4768-3p	PAR-CLIP	21572407
MIRT545170	hsa-miR-665	PAR-CLIP	21572407
MIRT545169	hsa-miR-6840-3p	PAR-CLIP	21572407
MIRT545168	hsa-miR-1915-3p	PAR-CLIP	21572407
MIRT545167	hsa-miR-6764-5p	PAR-CLIP	21572407
MIRT545166	hsa-miR-4726-3p	PAR-CLIP	21572407
MIRT545165	hsa-miR-7977	PAR-CLIP	21572407
MIRT545164	hsa-miR-203a-3p	PAR-CLIP	21572407
MIRT545163	hsa-miR-510-3p	PAR-CLIP	21572407
MIRT545174	hsa-miR-6888-5p	PAR-CLIP	21572407
MIRT545172	hsa-miR-3938	PAR-CLIP	21572407
MIRT545171	hsa-miR-4768-3p	PAR-CLIP	21572407
MIRT545170	hsa-miR-665	PAR-CLIP	21572407
MIRT545169	hsa-miR-6840-3p	PAR-CLIP	21572407
MIRT545168	hsa-miR-1915-3p	PAR-CLIP	21572407
MIRT545167	hsa-miR-6764-5p	PAR-CLIP	21572407
MIRT545166	hsa-miR-4726-3p	PAR-CLIP	21572407
MIRT545165	hsa-miR-7977	PAR-CLIP	21572407
MIRT545164	hsa-miR-203a-3p	PAR-CLIP	21572407
MIRT545163	hsa-miR-510-3p	PAR-CLIP	21572407
MIRT1382272	hsa-let-7a	CLIP-seq
MIRT1382273	hsa-let-7b	CLIP-seq
MIRT1382274	hsa-let-7c	CLIP-seq
MIRT1382275	hsa-let-7d	CLIP-seq
MIRT1382276	hsa-let-7e	CLIP-seq
MIRT1382277	hsa-let-7f	CLIP-seq
MIRT1382278	hsa-let-7g	CLIP-seq
MIRT1382279	hsa-let-7i	CLIP-seq
MIRT1382280	hsa-miR-1915	CLIP-seq
MIRT1382281	hsa-miR-202	CLIP-seq
MIRT1382282	hsa-miR-2052	CLIP-seq
MIRT1382283	hsa-miR-3143	CLIP-seq
MIRT1382284	hsa-miR-320a	CLIP-seq
MIRT1382285	hsa-miR-320b	CLIP-seq
MIRT1382286	hsa-miR-320c	CLIP-seq
MIRT1382287	hsa-miR-320d	CLIP-seq
MIRT1382288	hsa-miR-4269	CLIP-seq
MIRT1382289	hsa-miR-4429	CLIP-seq
MIRT1382290	hsa-miR-4458	CLIP-seq
MIRT1382291	hsa-miR-4500	CLIP-seq
MIRT1382292	hsa-miR-4688	CLIP-seq
MIRT1382293	hsa-miR-4709-3p	CLIP-seq
MIRT1382294	hsa-miR-486-3p	CLIP-seq
MIRT1382295	hsa-miR-543	CLIP-seq
MIRT1382296	hsa-miR-586	CLIP-seq
MIRT1382297	hsa-miR-610	CLIP-seq
MIRT1382298	hsa-miR-98	CLIP-seq
MIRT2114301	hsa-miR-1244	CLIP-seq
MIRT2114302	hsa-miR-1324	CLIP-seq
MIRT2114303	hsa-miR-133a	CLIP-seq
MIRT2114304	hsa-miR-133b	CLIP-seq
MIRT2114305	hsa-miR-2964a-3p	CLIP-seq
MIRT2114306	hsa-miR-371-5p	CLIP-seq
MIRT2114307	hsa-miR-371b-5p	CLIP-seq
MIRT2114308	hsa-miR-4276	CLIP-seq
MIRT2114309	hsa-miR-4302	CLIP-seq
MIRT2114310	hsa-miR-4649-3p	CLIP-seq
MIRT2114311	hsa-miR-4797-5p	CLIP-seq
MIRT2114312	hsa-miR-489	CLIP-seq
MIRT2114313	hsa-miR-514	CLIP-seq
MIRT2114314	hsa-miR-514b-3p	CLIP-seq
MIRT2114315	hsa-miR-548m	CLIP-seq
MIRT2114316	hsa-miR-562	CLIP-seq
MIRT2114317	hsa-miR-593	CLIP-seq
MIRT2337314	hsa-miR-1273f	CLIP-seq
MIRT2337315	hsa-miR-142-3p	CLIP-seq
MIRT2337316	hsa-miR-143	CLIP-seq
MIRT1382282	hsa-miR-2052	CLIP-seq
MIRT2337317	hsa-miR-3124-3p	CLIP-seq
MIRT2337318	hsa-miR-3688-3p	CLIP-seq
MIRT2337319	hsa-miR-4255	CLIP-seq
MIRT2337320	hsa-miR-4708-5p	CLIP-seq
MIRT2337321	hsa-miR-4770	CLIP-seq
MIRT2337322	hsa-miR-4795-3p	CLIP-seq
MIRT2440735	hsa-miR-3670	CLIP-seq
MIRT2440736	hsa-miR-4324	CLIP-seq
MIRT2440737	hsa-miR-4637	CLIP-seq
MIRT2440738	hsa-miR-556-5p	CLIP-seq
MIRT2460350	hsa-miR-340	CLIP-seq
MIRT2466169	hsa-miR-410	CLIP-seq
MIRT2466170	hsa-miR-4643	CLIP-seq
MIRT2630870	hsa-miR-1285	CLIP-seq
MIRT2630871	hsa-miR-1294	CLIP-seq
MIRT2630872	hsa-miR-1296	CLIP-seq
MIRT2630873	hsa-miR-1323	CLIP-seq
MIRT2630874	hsa-miR-181a	CLIP-seq
MIRT2630875	hsa-miR-181b	CLIP-seq
MIRT2630876	hsa-miR-181c	CLIP-seq
MIRT2630877	hsa-miR-181d	CLIP-seq
MIRT2630878	hsa-miR-1827	CLIP-seq
MIRT2630879	hsa-miR-191	CLIP-seq
MIRT2630880	hsa-miR-21	CLIP-seq
MIRT2630881	hsa-miR-2276	CLIP-seq
MIRT2630882	hsa-miR-2909	CLIP-seq
MIRT2630883	hsa-miR-299-3p	CLIP-seq
MIRT2630884	hsa-miR-3158-3p	CLIP-seq
MIRT2630885	hsa-miR-3160-3p	CLIP-seq
MIRT2630886	hsa-miR-3160-5p	CLIP-seq
MIRT2630887	hsa-miR-3187-5p	CLIP-seq
MIRT2630888	hsa-miR-3529	CLIP-seq
MIRT2630889	hsa-miR-3609	CLIP-seq
MIRT2630890	hsa-miR-3662	CLIP-seq
MIRT2440735	hsa-miR-3670	CLIP-seq
MIRT2114306	hsa-miR-371-5p	CLIP-seq
MIRT2114307	hsa-miR-371b-5p	CLIP-seq
MIRT2630891	hsa-miR-379	CLIP-seq
MIRT2630892	hsa-miR-3929	CLIP-seq
MIRT2466169	hsa-miR-410	CLIP-seq
MIRT2630893	hsa-miR-4262	CLIP-seq
MIRT2114308	hsa-miR-4276	CLIP-seq
MIRT2114309	hsa-miR-4302	CLIP-seq
MIRT2630894	hsa-miR-4310	CLIP-seq
MIRT2630895	hsa-miR-4316	CLIP-seq
MIRT2440736	hsa-miR-4324	CLIP-seq
MIRT2630896	hsa-miR-4419b	CLIP-seq
MIRT2630897	hsa-miR-4434	CLIP-seq
MIRT2630898	hsa-miR-4446-3p	CLIP-seq
MIRT2630899	hsa-miR-4451	CLIP-seq
MIRT2630900	hsa-miR-4477b	CLIP-seq
MIRT2630901	hsa-miR-4478	CLIP-seq
MIRT2630902	hsa-miR-4487	CLIP-seq
MIRT2630903	hsa-miR-4491	CLIP-seq
MIRT2630904	hsa-miR-4516	CLIP-seq
MIRT2630905	hsa-miR-4531	CLIP-seq
MIRT2440737	hsa-miR-4637	CLIP-seq
MIRT2630906	hsa-miR-4639-3p	CLIP-seq
MIRT2466170	hsa-miR-4643	CLIP-seq
MIRT2114310	hsa-miR-4649-3p	CLIP-seq
MIRT2630907	hsa-miR-4650-3p	CLIP-seq
MIRT2630908	hsa-miR-4657	CLIP-seq
MIRT2630909	hsa-miR-4675	CLIP-seq
MIRT2630910	hsa-miR-4698	CLIP-seq
MIRT2630911	hsa-miR-4699-3p	CLIP-seq
MIRT2630912	hsa-miR-4741	CLIP-seq
MIRT2630913	hsa-miR-4772-3p	CLIP-seq
MIRT2630914	hsa-miR-491-3p	CLIP-seq
MIRT2630915	hsa-miR-548a-3p	CLIP-seq
MIRT2630916	hsa-miR-548ah	CLIP-seq
MIRT2630917	hsa-miR-548e	CLIP-seq
MIRT2630918	hsa-miR-548f	CLIP-seq
MIRT2114315	hsa-miR-548m	CLIP-seq
MIRT2630919	hsa-miR-548n	CLIP-seq
MIRT2630920	hsa-miR-548o	CLIP-seq
MIRT2630921	hsa-miR-548t	CLIP-seq
MIRT2440738	hsa-miR-556-5p	CLIP-seq
MIRT2630922	hsa-miR-558	CLIP-seq
MIRT2630923	hsa-miR-576-3p	CLIP-seq
MIRT2630924	hsa-miR-590-5p	CLIP-seq
MIRT2114317	hsa-miR-593	CLIP-seq
MIRT2630925	hsa-miR-612	CLIP-seq
MIRT2630926	hsa-miR-626	CLIP-seq
MIRT2630927	hsa-miR-664	CLIP-seq
MIRT2630928	hsa-miR-758	CLIP-seq
MIRT2630871	hsa-miR-1294	CLIP-seq
MIRT2630873	hsa-miR-1323	CLIP-seq
MIRT2630874	hsa-miR-181a	CLIP-seq
MIRT2630875	hsa-miR-181b	CLIP-seq
MIRT2630876	hsa-miR-181c	CLIP-seq
MIRT2630877	hsa-miR-181d	CLIP-seq
MIRT2630878	hsa-miR-1827	CLIP-seq
MIRT2630880	hsa-miR-21	CLIP-seq
MIRT2630881	hsa-miR-2276	CLIP-seq
MIRT2630883	hsa-miR-299-3p	CLIP-seq
MIRT2630885	hsa-miR-3160-3p	CLIP-seq
MIRT2630890	hsa-miR-3662	CLIP-seq
MIRT2114306	hsa-miR-371-5p	CLIP-seq
MIRT2114307	hsa-miR-371b-5p	CLIP-seq
MIRT2466169	hsa-miR-410	CLIP-seq
MIRT2630893	hsa-miR-4262	CLIP-seq
MIRT2114308	hsa-miR-4276	CLIP-seq
MIRT2114309	hsa-miR-4302	CLIP-seq
MIRT2630895	hsa-miR-4316	CLIP-seq
MIRT2630897	hsa-miR-4434	CLIP-seq
MIRT2630902	hsa-miR-4487	CLIP-seq
MIRT2630903	hsa-miR-4491	CLIP-seq
MIRT2630904	hsa-miR-4516	CLIP-seq
MIRT2630905	hsa-miR-4531	CLIP-seq
MIRT2466170	hsa-miR-4643	CLIP-seq
MIRT2114310	hsa-miR-4649-3p	CLIP-seq
MIRT2630908	hsa-miR-4657	CLIP-seq
MIRT2630911	hsa-miR-4699-3p	CLIP-seq
MIRT2630913	hsa-miR-4772-3p	CLIP-seq
MIRT2630914	hsa-miR-491-3p	CLIP-seq
MIRT2630915	hsa-miR-548a-3p	CLIP-seq
MIRT2630917	hsa-miR-548e	CLIP-seq
MIRT2630918	hsa-miR-548f	CLIP-seq
MIRT2114315	hsa-miR-548m	CLIP-seq
MIRT2630920	hsa-miR-548o	CLIP-seq
MIRT2630922	hsa-miR-558	CLIP-seq
MIRT2630923	hsa-miR-576-3p	CLIP-seq
MIRT2630924	hsa-miR-590-5p	CLIP-seq
MIRT2114317	hsa-miR-593	CLIP-seq
MIRT2630927	hsa-miR-664	CLIP-seq
MIRT2630928	hsa-miR-758	CLIP-seq

Show/Hide all (33)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	21264221, 22292033, 32296183
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IDA	21264221, 21264228
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IDA	38322995
GO:0005739	Component	Mitochondrion	IDA	21264221
GO:0005739	Component	Mitochondrion	IEA
GO:0005741	Component	Mitochondrial outer membrane	IBA
GO:0005741	Component	Mitochondrial outer membrane	IDA	21264228
GO:0005741	Component	Mitochondrial outer membrane	IEA
GO:0005759	Component	Mitochondrial matrix	IDA	22532927, 38322995
GO:0005759	Component	Mitochondrial matrix	IEA
GO:0005829	Component	Cytosol	IDA	22532927
GO:0005829	Component	Cytosol	IEA
GO:0008289	Function	Lipid binding	IEA
GO:0016020	Component	Membrane	IEA
GO:0016024	Process	CDP-diacylglycerol biosynthetic process	ISS
GO:0032049	Process	Cardiolipin biosynthetic process	IDA	16678169
GO:0032049	Process	Cardiolipin biosynthetic process	ISS
GO:0035694	Process	Mitochondrial protein catabolic process	IBA
GO:0035694	Process	Mitochondrial protein catabolic process	IEA
GO:0035694	Process	Mitochondrial protein catabolic process	IMP	21264221, 21264228
GO:0035695	Process	Mitophagy by internal vacuole formation	IBA
GO:0035695	Process	Mitophagy by internal vacuole formation	IMP	21264228
GO:0035965	Process	Cardiolipin acyl-chain remodeling	IDA	23152787, 23533611
GO:0035965	Process	Cardiolipin acyl-chain remodeling	TAS	38322995
GO:0042802	Function	Identical protein binding	IPI	32296183
GO:0043231	Component	Intracellular membrane-bounded organelle	IDA	21264228
GO:0043232	Component	Intracellular membraneless organelle	IDA	38322995
GO:0140693	Function	Molecular condensate scaffold activity	IDA	38322995
GO:1900210	Process	Positive regulation of cardiolipin metabolic process	IMP	38322995
GO:1901612	Function	Cardiolipin binding	IDA	38322995

MIM	HGNC	e!Ensembl
612814	29579	ENSG00000163071

Q8TC71

Protein name

Mitochondria-eating protein (Spermatogenesis-associated protein 18)

Protein function

Key regulator of mitochondrial quality that mediates the repairing or degradation of unhealthy mitochondria in response to mitochondrial damage (PubMed:21264221, PubMed:21264228, PubMed:22292033, PubMed:22532927). Mediator of mitochondrial prote

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF16026	MIEAP	298 → 486	Mitochondria-eating protein	Family

Sequence

MAENLKRLVSNETLRTLQEKLDFWLKEYNTNTCDQNLNHCLELIEQVAKVQGQLFGILTA
AAQEGGRNDGVETIKSRLLPWLEASFTAASLGKSVDSKVPSLQDTFDRERHKDPSPRDRD
MQQLDSNLNSTRSQCNQVQDDLVETEKNLEESKNRSAISLLAAEEEINQLKKQLKSLQAQ
EDARHRNTDQRSSENRRSEPWSLEERKREQWNSLKQNADQQDTEAMSDYKKQLRNLKEEI
AVLSAEKSALQGRSSRSRSPSPAPRSRSCSRSRSASPSTAVKVRRPSPNRSKLSNVARKA
ALLSRFSDSYSQARLDAQCLLRRCIDKAETVQRIIYIATVEAFHVAKMAFRHFKIHVRKS
LTPSYVGSNDFENAVLDYVICHLDLYDSQSSVNDVIRAMNVNPKISFPPVVDFCLLSDFI
QEICCIAFAMQALEPPLDIAYGADGEVFNDCKYRRSYDSDFTAPLVLYHVWPALMENDCV
IMKGEAVTRRGAFWNSVRSVSRCRSRSLSPICPRSQIGLNTMSRSRSPSPIRCGLPRF

Sequence length

538

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (9)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BREAST NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IDIOPATHIC OSTEONECROSIS OF THE FEMORAL HEAD	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate cancer	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UTERINE FIBROID	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (24)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	29915430		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	30290054		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	30290054	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma Ductal	Ductal carcinoma	Pubtator	30290054	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	36751118	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	30247079		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	30290054, 35269894	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	32736677	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibroadenoma	Fibroadenoma	BEFREE	30290054		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	32736677	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	35269894	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	29915430		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	30290054		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	29610475		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	29915430		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	29915430		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	29915430		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	21264221	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophies, Limb-Girdle	Limb-Girdle Muscular Dystrophy	LHGDN	16088906		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	30290054		★★★★★ ★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	30290054		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peritonitis	Peritonitis	Pubtator	35269894	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	29610475		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach neoplasms	Pubtator	32736677	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

SPATA18 (spermatogenesis associated 18)