Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Entrez ID	132625
Gene name	ZFP42 zinc finger protein
Gene symbol	ZFP42
Synonyms (NCBI Gene)	REX-1REX1ZNF754zfp-42
Chromosome	4
Chromosome location	4q35.2

124

Show/Hide all (124)

miRTarBase ID	miRNA	Experiments	Reference
MIRT530012	hsa-miR-1277-5p	PAR-CLIP	22012620
MIRT530011	hsa-miR-5692b	PAR-CLIP	22012620
MIRT530010	hsa-miR-5692c	PAR-CLIP	22012620
MIRT530009	hsa-miR-323b-3p	PAR-CLIP	22012620
MIRT458359	hsa-miR-4704-5p	PAR-CLIP	23592263
MIRT458358	hsa-miR-3117-5p	PAR-CLIP	23592263
MIRT458357	hsa-miR-6807-5p	PAR-CLIP	23592263
MIRT458357	hsa-miR-6807-5p	PAR-CLIP	27292025
MIRT530012	hsa-miR-1277-5p	PAR-CLIP	22012620
MIRT530011	hsa-miR-5692b	PAR-CLIP	22012620
MIRT530010	hsa-miR-5692c	PAR-CLIP	22012620
MIRT530009	hsa-miR-323b-3p	PAR-CLIP	22012620
MIRT458359	hsa-miR-4704-5p	PAR-CLIP	23592263
MIRT458358	hsa-miR-3117-5p	PAR-CLIP	23592263
MIRT458357	hsa-miR-6807-5p	PAR-CLIP	23592263
MIRT1511675	hsa-miR-1183	CLIP-seq
MIRT1511676	hsa-miR-1208	CLIP-seq
MIRT1511677	hsa-miR-129-5p	CLIP-seq
MIRT1511678	hsa-miR-154	CLIP-seq
MIRT1511679	hsa-miR-3123	CLIP-seq
MIRT1511680	hsa-miR-3137	CLIP-seq
MIRT1511681	hsa-miR-34b	CLIP-seq
MIRT1511682	hsa-miR-3614-5p	CLIP-seq
MIRT1511683	hsa-miR-3672	CLIP-seq
MIRT1511684	hsa-miR-3674	CLIP-seq
MIRT1511685	hsa-miR-371-5p	CLIP-seq
MIRT1511686	hsa-miR-3919	CLIP-seq
MIRT1511687	hsa-miR-4433	CLIP-seq
MIRT1511688	hsa-miR-4459	CLIP-seq
MIRT1511689	hsa-miR-4695-3p	CLIP-seq
MIRT1511690	hsa-miR-4705	CLIP-seq
MIRT1511691	hsa-miR-4732-5p	CLIP-seq
MIRT1511692	hsa-miR-4768-3p	CLIP-seq
MIRT1511693	hsa-miR-493	CLIP-seq
MIRT1511694	hsa-miR-541	CLIP-seq
MIRT1511695	hsa-miR-654-5p	CLIP-seq
MIRT1511675	hsa-miR-1183	CLIP-seq
MIRT1511676	hsa-miR-1208	CLIP-seq
MIRT2154031	hsa-miR-1228	CLIP-seq
MIRT2154032	hsa-miR-2114	CLIP-seq
MIRT1511679	hsa-miR-3123	CLIP-seq
MIRT1511680	hsa-miR-3137	CLIP-seq
MIRT2154033	hsa-miR-329	CLIP-seq
MIRT1511681	hsa-miR-34b	CLIP-seq
MIRT1511682	hsa-miR-3614-5p	CLIP-seq
MIRT2154034	hsa-miR-362-3p	CLIP-seq
MIRT1511684	hsa-miR-3674	CLIP-seq
MIRT2154035	hsa-miR-3689a-3p	CLIP-seq
MIRT2154036	hsa-miR-3689c	CLIP-seq
MIRT1511686	hsa-miR-3919	CLIP-seq
MIRT2154037	hsa-miR-4649-3p	CLIP-seq
MIRT1511689	hsa-miR-4695-3p	CLIP-seq
MIRT2154038	hsa-miR-4704-3p	CLIP-seq
MIRT1511690	hsa-miR-4705	CLIP-seq
MIRT2154039	hsa-miR-4711-5p	CLIP-seq
MIRT2154040	hsa-miR-4728-5p	CLIP-seq
MIRT1511691	hsa-miR-4732-5p	CLIP-seq
MIRT2154041	hsa-miR-4781-3p	CLIP-seq
MIRT2154042	hsa-miR-485-5p	CLIP-seq
MIRT2154043	hsa-miR-516b	CLIP-seq
MIRT2154044	hsa-miR-642b	CLIP-seq
MIRT2154045	hsa-miR-890	CLIP-seq
MIRT1511675	hsa-miR-1183	CLIP-seq
MIRT1511676	hsa-miR-1208	CLIP-seq
MIRT2154031	hsa-miR-1228	CLIP-seq
MIRT2154032	hsa-miR-2114	CLIP-seq
MIRT2374241	hsa-miR-3122	CLIP-seq
MIRT1511679	hsa-miR-3123	CLIP-seq
MIRT1511680	hsa-miR-3137	CLIP-seq
MIRT2374242	hsa-miR-342-3p	CLIP-seq
MIRT1511681	hsa-miR-34b	CLIP-seq
MIRT1511682	hsa-miR-3614-5p	CLIP-seq
MIRT1511683	hsa-miR-3672	CLIP-seq
MIRT2154035	hsa-miR-3689a-3p	CLIP-seq
MIRT2154036	hsa-miR-3689c	CLIP-seq
MIRT1511685	hsa-miR-371-5p	CLIP-seq
MIRT2374243	hsa-miR-3913-5p	CLIP-seq
MIRT1511686	hsa-miR-3919	CLIP-seq
MIRT2374244	hsa-miR-3929	CLIP-seq
MIRT2374245	hsa-miR-4419b	CLIP-seq
MIRT2374246	hsa-miR-4478	CLIP-seq
MIRT2154037	hsa-miR-4649-3p	CLIP-seq
MIRT1511690	hsa-miR-4705	CLIP-seq
MIRT2154040	hsa-miR-4728-5p	CLIP-seq
MIRT2154042	hsa-miR-485-5p	CLIP-seq
MIRT2154043	hsa-miR-516b	CLIP-seq
MIRT1511694	hsa-miR-541	CLIP-seq
MIRT2374247	hsa-miR-622	CLIP-seq
MIRT2154044	hsa-miR-642b	CLIP-seq
MIRT1511695	hsa-miR-654-5p	CLIP-seq
MIRT2154045	hsa-miR-890	CLIP-seq
MIRT2154031	hsa-miR-1228	CLIP-seq
MIRT2463944	hsa-miR-1268	CLIP-seq
MIRT2463945	hsa-miR-1268b	CLIP-seq
MIRT2463946	hsa-miR-3675-3p	CLIP-seq
MIRT2463947	hsa-miR-4684-5p	CLIP-seq
MIRT2463948	hsa-miR-548c-3p	CLIP-seq
MIRT2154031	hsa-miR-1228	CLIP-seq
MIRT2463944	hsa-miR-1268	CLIP-seq
MIRT2463945	hsa-miR-1268b	CLIP-seq
MIRT2374241	hsa-miR-3122	CLIP-seq
MIRT2463946	hsa-miR-3675-3p	CLIP-seq
MIRT2154035	hsa-miR-3689a-3p	CLIP-seq
MIRT2154036	hsa-miR-3689c	CLIP-seq
MIRT2374243	hsa-miR-3913-5p	CLIP-seq
MIRT2463947	hsa-miR-4684-5p	CLIP-seq
MIRT2154040	hsa-miR-4728-5p	CLIP-seq
MIRT1511694	hsa-miR-541	CLIP-seq
MIRT2463948	hsa-miR-548c-3p	CLIP-seq
MIRT1511695	hsa-miR-654-5p	CLIP-seq
MIRT2154031	hsa-miR-1228	CLIP-seq
MIRT2463944	hsa-miR-1268	CLIP-seq
MIRT2463945	hsa-miR-1268b	CLIP-seq
MIRT2374241	hsa-miR-3122	CLIP-seq
MIRT1511683	hsa-miR-3672	CLIP-seq
MIRT2463946	hsa-miR-3675-3p	CLIP-seq
MIRT2154035	hsa-miR-3689a-3p	CLIP-seq
MIRT2154036	hsa-miR-3689c	CLIP-seq
MIRT2374243	hsa-miR-3913-5p	CLIP-seq
MIRT2463947	hsa-miR-4684-5p	CLIP-seq
MIRT2154040	hsa-miR-4728-5p	CLIP-seq
MIRT1511694	hsa-miR-541	CLIP-seq
MIRT2463948	hsa-miR-548c-3p	CLIP-seq
MIRT1511695	hsa-miR-654-5p	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
POU5F1	Activation	17068183

Show/Hide all (18)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	NAS	14688391
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005634	Component	Nucleus	IEA
GO:0005667	Component	Transcription regulator complex	IBA
GO:0005737	Component	Cytoplasm	IDA	16344273, 18281244
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0008270	Function	Zinc ion binding	IEA
GO:0008584	Process	Male gonad development	IEP	18281244
GO:0008585	Process	Female gonad development	IEP	18281244
GO:0031519	Component	PcG protein complex	IBA
GO:0046872	Function	Metal ion binding	IEA
GO:0051321	Process	Meiotic cell cycle	NAS	18281244
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IEA

MIM	HGNC	e!Ensembl
614572	30949	ENSG00000179059

Q96MM3

Protein name

Zinc finger protein 42 homolog (Zfp-42) (Reduced expression protein 1) (REX-1) (hREX-1) (Zinc finger protein 754)

Protein function

Involved in the reprogramming of X-chromosome inactivation during the acquisition of pluripotency. Required for efficient elongation of TSIX, a non-coding RNA antisense to XIST. Binds DXPas34 enhancer within the TSIX promoter. Involved in ES cel

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00096	zf-C2H2	217 → 239	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	245 → 269	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	275 → 299	Zinc finger, C2H2 type	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in kidney, epidermal keratinocytes, prostate epithelial cells, bronchial and small airway lung epithelial cells (at protein level). Expressed in malignant kidney and several carcinoma cell lines (at protein level). Expressed

Sequence

MSQQLKKRAKTRHQKGLGGRAPSGAKPRQGKSSQDLQAEIEPVSAVWALCDGYVCYEPGP
QALGGDDFSDCYIECVIRGEFSQPILEEDSLFESLEYLKKGSEQQLSQKVFEASSLECSL
EYMKKGVKKELPQKIVGENSLEYSEYMTGKKLPPGGIPGIDLSDPKQLAEFARKKPPINK
EYDSLSAIACPQSGCTRKLRNRAALRKHLLIHGPRDHVCAECGKAFVESSKLKRHFLVHT
GEKPFRCTFEGCGKRFSLDFNLRTHVRIHTGEKRFVCPFQGCNRRFIQSNNLKAHILTHA
NTNKNEQEGK

Sequence length

310

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (5)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TESTICULAR CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TESTICULAR GERM CELL TUMOR	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (28)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma, Clear Cell	Adenocarcinoma	BEFREE	16344273		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	22610075	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	21446939	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	31409905		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	31409905		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	38092774	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	16344273		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	19690622		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	19690622	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	21810014		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	21810014		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hurthle Cell Tumor	Tumor	BEFREE	16344273		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasm	Kidney Neoplasm	BEFREE	16344273		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	31680287		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	37563730	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	21638208, 21810014		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	31409905		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	31409905, 31680287		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oxyphilic Adenoma	Oxyphilic Adenoma	BEFREE	16344273		★★★★★ ★☆☆☆☆ Found in Text Mining only
PACHYONYCHIA CONGENITA 3	Pachyonychia Congenita	BEFREE	20232320		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	20232320, 34183450	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Refractory anemias	Anemia	BEFREE	20232320		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	16344273		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	20232320		★★★★★ ★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	BEFREE	16397242, 16424014		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	34406843	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Teratoma	Teratoma	BEFREE	28253351		★★★★★ ★☆☆☆☆ Found in Text Mining only
Testicular Germ Cell Tumor	Testicular Germ Cell Tumor	GWASCAT_DG	28604728, 28604732		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

ZFP42 (ZFP42 zinc finger protein)