Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	1326
Gene name	Mitogen-activated protein kinase kinase kinase 8
Gene symbol	MAP3K8
Synonyms (NCBI Gene)	AURA2COTESTESTFMEKK8TPL2Tpl-2c-COT
Chromosome	10
Chromosome location	10p11.23
Summary	This gene is an oncogene that encodes a member of the serine/threonine protein kinase family. The encoded protein localizes to the cytoplasm and can activate both the MAP kinase and JNK kinase pathways. This protein was shown to activate IkappaB kinases,

203

Show/Hide all (203)

miRTarBase ID	miRNA	Experiments	Reference
MIRT001074	hsa-miR-370-3p	Luciferase reporter assayWestern blot	17621267
MIRT001074	hsa-miR-370-3p	Luciferase reporter assay	17621267
MIRT007200	hsa-miR-375	Luciferase reporter assay	23430746
MIRT007200	hsa-miR-375	Luciferase reporter assay	23430746
MIRT016056	hsa-miR-374b-5p	Sequencing	20371350
MIRT017102	hsa-miR-335-5p	Microarray	18185580
MIRT001074	hsa-miR-370-3p	Other	17621267
MIRT022367	hsa-miR-124-3p	Microarray	18668037
MIRT051038	hsa-miR-17-5p	CLASH	23622248
MIRT053364	hsa-miR-9-5p	MicroarrayqRT-PCR	23798388
MIRT731324	mmu-miR-509-3p	Luciferase reporter assay	27001999
MIRT731324	mmu-miR-509-3p	Luciferase reporter assay	27001999
MIRT731324	mmu-miR-509-3p	Luciferase reporter assay	27001999
MIRT731324	mmu-miR-509-3p	Luciferase reporter assay	27001999
MIRT731688	hsa-miR-144-3p	Luciferase reporter assayqRT-PCRWestern blot	27717821
MIRT731688	hsa-miR-144-3p	Luciferase reporter assayqRT-PCRWestern blot	27717821
MIRT007200	hsa-miR-375	Western blot	28186962
MIRT1129092	hsa-miR-101	CLIP-seq
MIRT1129093	hsa-miR-106a	CLIP-seq
MIRT1129094	hsa-miR-106b	CLIP-seq
MIRT1129095	hsa-miR-1257	CLIP-seq
MIRT1129096	hsa-miR-128	CLIP-seq
MIRT1129097	hsa-miR-132	CLIP-seq
MIRT1129098	hsa-miR-1323	CLIP-seq
MIRT1129099	hsa-miR-144	CLIP-seq
MIRT1129100	hsa-miR-17	CLIP-seq
MIRT1129101	hsa-miR-181a	CLIP-seq
MIRT1129102	hsa-miR-181b	CLIP-seq
MIRT1129103	hsa-miR-181c	CLIP-seq
MIRT1129104	hsa-miR-181d	CLIP-seq
MIRT1129105	hsa-miR-2052	CLIP-seq
MIRT1129106	hsa-miR-20a	CLIP-seq
MIRT1129107	hsa-miR-20b	CLIP-seq
MIRT1129108	hsa-miR-212	CLIP-seq
MIRT1129109	hsa-miR-214	CLIP-seq
MIRT1129110	hsa-miR-23a	CLIP-seq
MIRT1129111	hsa-miR-23b	CLIP-seq
MIRT1129112	hsa-miR-23c	CLIP-seq
MIRT1129113	hsa-miR-3163	CLIP-seq
MIRT1129114	hsa-miR-3166	CLIP-seq
MIRT1129115	hsa-miR-3612	CLIP-seq
MIRT1129116	hsa-miR-3619-5p	CLIP-seq
MIRT1129117	hsa-miR-3671	CLIP-seq
MIRT1129118	hsa-miR-3918	CLIP-seq
MIRT1129119	hsa-miR-4262	CLIP-seq
MIRT1129120	hsa-miR-4291	CLIP-seq
MIRT1129121	hsa-miR-4310	CLIP-seq
MIRT1129122	hsa-miR-432	CLIP-seq
MIRT1129123	hsa-miR-4443	CLIP-seq
MIRT1129124	hsa-miR-448	CLIP-seq
MIRT1129125	hsa-miR-4484	CLIP-seq
MIRT1129126	hsa-miR-4717-3p	CLIP-seq
MIRT1129127	hsa-miR-494	CLIP-seq
MIRT1129128	hsa-miR-499-3p	CLIP-seq
MIRT1129129	hsa-miR-499a-3p	CLIP-seq
MIRT1129130	hsa-miR-519a	CLIP-seq
MIRT1129131	hsa-miR-519b-3p	CLIP-seq
MIRT1129132	hsa-miR-519c-3p	CLIP-seq
MIRT1129133	hsa-miR-519d	CLIP-seq
MIRT1129134	hsa-miR-548an	CLIP-seq
MIRT1129135	hsa-miR-548o	CLIP-seq
MIRT1129136	hsa-miR-548q	CLIP-seq
MIRT1129137	hsa-miR-650	CLIP-seq
MIRT1129138	hsa-miR-761	CLIP-seq
MIRT1129139	hsa-miR-922	CLIP-seq
MIRT1129140	hsa-miR-93	CLIP-seq
MIRT1129092	hsa-miR-101	CLIP-seq
MIRT2036732	hsa-miR-1197	CLIP-seq
MIRT2036733	hsa-miR-1245b-3p	CLIP-seq
MIRT2036734	hsa-miR-1297	CLIP-seq
MIRT2036735	hsa-miR-135a	CLIP-seq
MIRT2036736	hsa-miR-135b	CLIP-seq
MIRT2036737	hsa-miR-137	CLIP-seq
MIRT1129099	hsa-miR-144	CLIP-seq
MIRT1129105	hsa-miR-2052	CLIP-seq
MIRT2036738	hsa-miR-21	CLIP-seq
MIRT2036739	hsa-miR-221	CLIP-seq
MIRT2036740	hsa-miR-222	CLIP-seq
MIRT2036741	hsa-miR-26a	CLIP-seq
MIRT2036742	hsa-miR-26b	CLIP-seq
MIRT2036743	hsa-miR-3117-3p	CLIP-seq
MIRT2036744	hsa-miR-3117-5p	CLIP-seq
MIRT1129114	hsa-miR-3166	CLIP-seq
MIRT2036745	hsa-miR-362-5p	CLIP-seq
MIRT2036746	hsa-miR-3677-5p	CLIP-seq
MIRT2036747	hsa-miR-370	CLIP-seq
MIRT2036748	hsa-miR-382	CLIP-seq
MIRT2036749	hsa-miR-4267	CLIP-seq
MIRT2036750	hsa-miR-4273	CLIP-seq
MIRT2036751	hsa-miR-4282	CLIP-seq
MIRT1129120	hsa-miR-4291	CLIP-seq
MIRT1129121	hsa-miR-4310	CLIP-seq
MIRT2036752	hsa-miR-4465	CLIP-seq
MIRT2036753	hsa-miR-4520a-3p	CLIP-seq
MIRT2036754	hsa-miR-4520b-3p	CLIP-seq
MIRT2036755	hsa-miR-4662a-5p	CLIP-seq
MIRT2036756	hsa-miR-4677-5p	CLIP-seq
MIRT2036757	hsa-miR-4704-5p	CLIP-seq
MIRT2036758	hsa-miR-4735-5p	CLIP-seq
MIRT2036759	hsa-miR-4760-3p	CLIP-seq
MIRT2036760	hsa-miR-500b	CLIP-seq
MIRT2036761	hsa-miR-501-5p	CLIP-seq
MIRT2036762	hsa-miR-520d-5p	CLIP-seq
MIRT2036763	hsa-miR-524-5p	CLIP-seq
MIRT2036764	hsa-miR-548n	CLIP-seq
MIRT2036765	hsa-miR-548v	CLIP-seq
MIRT2036766	hsa-miR-554	CLIP-seq
MIRT2036767	hsa-miR-576-5p	CLIP-seq
MIRT2036768	hsa-miR-587	CLIP-seq
MIRT2036769	hsa-miR-590-5p	CLIP-seq
MIRT2036770	hsa-miR-626	CLIP-seq
MIRT2036771	hsa-miR-651	CLIP-seq
MIRT2036772	hsa-miR-668	CLIP-seq
MIRT1129139	hsa-miR-922	CLIP-seq
MIRT2036773	hsa-miR-935	CLIP-seq
MIRT2036732	hsa-miR-1197	CLIP-seq
MIRT2036733	hsa-miR-1245b-3p	CLIP-seq
MIRT1129097	hsa-miR-132	CLIP-seq
MIRT2036735	hsa-miR-135a	CLIP-seq
MIRT2036736	hsa-miR-135b	CLIP-seq
MIRT2036737	hsa-miR-137	CLIP-seq
MIRT2036738	hsa-miR-21	CLIP-seq
MIRT1129108	hsa-miR-212	CLIP-seq
MIRT1129109	hsa-miR-214	CLIP-seq
MIRT2036739	hsa-miR-221	CLIP-seq
MIRT2036740	hsa-miR-222	CLIP-seq
MIRT2266937	hsa-miR-296-5p	CLIP-seq
MIRT2036743	hsa-miR-3117-3p	CLIP-seq
MIRT2036744	hsa-miR-3117-5p	CLIP-seq
MIRT1129114	hsa-miR-3166	CLIP-seq
MIRT1129116	hsa-miR-3619-5p	CLIP-seq
MIRT2266938	hsa-miR-3662	CLIP-seq
MIRT2036746	hsa-miR-3677-5p	CLIP-seq
MIRT2036747	hsa-miR-370	CLIP-seq
MIRT2266939	hsa-miR-3914	CLIP-seq
MIRT2036749	hsa-miR-4267	CLIP-seq
MIRT1129120	hsa-miR-4291	CLIP-seq
MIRT2036757	hsa-miR-4704-5p	CLIP-seq
MIRT2036758	hsa-miR-4735-5p	CLIP-seq
MIRT2266940	hsa-miR-4738-3p	CLIP-seq
MIRT2036759	hsa-miR-4760-3p	CLIP-seq
MIRT1129127	hsa-miR-494	CLIP-seq
MIRT2266941	hsa-miR-548g	CLIP-seq
MIRT2036765	hsa-miR-548v	CLIP-seq
MIRT2036766	hsa-miR-554	CLIP-seq
MIRT2036767	hsa-miR-576-5p	CLIP-seq
MIRT2036768	hsa-miR-587	CLIP-seq
MIRT2036769	hsa-miR-590-5p	CLIP-seq
MIRT2036770	hsa-miR-626	CLIP-seq
MIRT2036771	hsa-miR-651	CLIP-seq
MIRT2036772	hsa-miR-668	CLIP-seq
MIRT1129138	hsa-miR-761	CLIP-seq
MIRT1129139	hsa-miR-922	CLIP-seq
MIRT2036732	hsa-miR-1197	CLIP-seq
MIRT2036733	hsa-miR-1245b-3p	CLIP-seq
MIRT2036735	hsa-miR-135a	CLIP-seq
MIRT2036736	hsa-miR-135b	CLIP-seq
MIRT2036737	hsa-miR-137	CLIP-seq
MIRT2566512	hsa-miR-200b	CLIP-seq
MIRT2566513	hsa-miR-200c	CLIP-seq
MIRT2036738	hsa-miR-21	CLIP-seq
MIRT2036739	hsa-miR-221	CLIP-seq
MIRT2036740	hsa-miR-222	CLIP-seq
MIRT2566514	hsa-miR-3074-5p	CLIP-seq
MIRT2036743	hsa-miR-3117-3p	CLIP-seq
MIRT2036744	hsa-miR-3117-5p	CLIP-seq
MIRT2566515	hsa-miR-3182	CLIP-seq
MIRT2036746	hsa-miR-3677-5p	CLIP-seq
MIRT2036747	hsa-miR-370	CLIP-seq
MIRT2566516	hsa-miR-371-5p	CLIP-seq
MIRT2566517	hsa-miR-371b-5p	CLIP-seq
MIRT2036749	hsa-miR-4267	CLIP-seq
MIRT2566518	hsa-miR-429	CLIP-seq
MIRT2036755	hsa-miR-4662a-5p	CLIP-seq
MIRT2566519	hsa-miR-4677-3p	CLIP-seq
MIRT2566520	hsa-miR-4679	CLIP-seq
MIRT2566521	hsa-miR-4680-3p	CLIP-seq
MIRT2566522	hsa-miR-4680-5p	CLIP-seq
MIRT2036757	hsa-miR-4704-5p	CLIP-seq
MIRT2566523	hsa-miR-4722-3p	CLIP-seq
MIRT2566524	hsa-miR-4724-5p	CLIP-seq
MIRT2036758	hsa-miR-4735-5p	CLIP-seq
MIRT2036759	hsa-miR-4760-3p	CLIP-seq
MIRT2036765	hsa-miR-548v	CLIP-seq
MIRT2036766	hsa-miR-554	CLIP-seq
MIRT2036767	hsa-miR-576-5p	CLIP-seq
MIRT2036769	hsa-miR-590-5p	CLIP-seq
MIRT2036770	hsa-miR-626	CLIP-seq
MIRT2036771	hsa-miR-651	CLIP-seq
MIRT2036772	hsa-miR-668	CLIP-seq
MIRT2036773	hsa-miR-935	CLIP-seq
MIRT2036733	hsa-miR-1245b-3p	CLIP-seq
MIRT2036735	hsa-miR-135a	CLIP-seq
MIRT2036736	hsa-miR-135b	CLIP-seq
MIRT2036743	hsa-miR-3117-3p	CLIP-seq
MIRT2036746	hsa-miR-3677-5p	CLIP-seq
MIRT2036747	hsa-miR-370	CLIP-seq
MIRT2036758	hsa-miR-4735-5p	CLIP-seq
MIRT2036759	hsa-miR-4760-3p	CLIP-seq
MIRT2036767	hsa-miR-576-5p	CLIP-seq
MIRT2036770	hsa-miR-626	CLIP-seq
MIRT2036771	hsa-miR-651	CLIP-seq
MIRT2036772	hsa-miR-668	CLIP-seq

Show/Hide all (26)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	IBA
GO:0000165	Process	MAPK cascade	IDA	1833717
GO:0000166	Function	Nucleotide binding	IEA
GO:0000287	Function	Magnesium ion binding	IEA
GO:0002376	Process	Immune system process	IEA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	TAS	8226782
GO:0004709	Function	MAP kinase kinase kinase activity	IDA	1833717
GO:0004709	Function	MAP kinase kinase kinase activity	IEA
GO:0004709	Function	MAP kinase kinase kinase activity	TAS
GO:0005515	Function	Protein binding	IPI	12832462, 14743216, 15169888, 21988832, 22939624, 24265246, 25609649, 25852190, 35140242
GO:0005524	Function	ATP binding	IEA
GO:0005737	Component	Cytoplasm	IDA	1833717
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS	8226782
GO:0006468	Process	Protein phosphorylation	TAS	2072910
GO:0007165	Process	Signal transduction	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0031295	Process	T cell costimulation	TAS
GO:0046872	Function	Metal ion binding	IEA
GO:0050729	Process	Positive regulation of inflammatory response	IDA	16424369
GO:0106310	Function	Protein serine kinase activity	IEA

MIM	HGNC	e!Ensembl
191195	6860	ENSG00000107968

P41279

Protein name

Mitogen-activated protein kinase kinase kinase 8 (EC 2.7.11.25) (Cancer Osaka thyroid oncogene) (Proto-oncogene c-Cot) (Serine/threonine-protein kinase cot) (Tumor progression locus 2) (TPL-2)

Protein function

Required for lipopolysaccharide (LPS)-induced, TLR4-mediated activation of the MAPK/ERK pathway in macrophages, thus being critical for production of the pro-inflammatory cytokine TNF-alpha (TNF) during immune responses. Involved in the regulati

PDB

4Y83 , 4Y85 , 5IU2

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00069	Pkinase	139 → 388	Protein kinase domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in several normal tissues and human tumor-derived cell lines.

Sequence

MEYMSTGSDNKEEIDLLIKHLNVSDVIDIMENLYASEEPAVYEPSLMTMCQDSNQNDERS
KSLLLSGQEVPWLSSVRYGTVEDLLAFANHISNTAKHFYGQRPQESGILLNMVITPQNGR
YQIDSDVLLIPWKLTYRNIGSDFIPRGAFGKVYLAQDIKTKKRMACKLIPVDQFKPSDVE
IQACFRHENIAELYGAVLWGETVHLFMEAGEGGSVLEKLESCGPMREFEIIWVTKHVLKG
LDFLHSKKVIHHDIKPSNIVFMSTKAVLVDFGLSVQMTEDVYFPKDLRGTEIYMSPEVIL
CRGHSTKADIYSLGATLIHMQTGTPPWVKRYPRSAYPSYLYIIHKQAPPLEDIADDCSPG
MRELIEASLERNPNHRPRAADLLKHEALNPPREDQPRCQSLDSALLERKRLLSRKELELP
ENIADSSCTGSTEESEMLKRQRSLYIDLGALAGYFNLVRGPPTLEYG

Sequence length

467

Interactions

View interactions

	KEGG		Reactome
	MAPK signaling pathway Toll-like receptor signaling pathway T cell receptor signaling pathway TNF signaling pathway		CD28 dependent PI3K/Akt signaling MAP3K8 (TPL2)-dependent MAPK1/3 activation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (11)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Acute myeloid leukemia	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CANCER	—	ClinVar, HPO ClinVar, HPO	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAP3K8-related disorder	Uncertain significance; Likely benign; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (154)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma	Adenocarcinoma	BEFREE	28393206		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	15015574		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	15287022		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	26560698		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	14659882		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Oligodendroglioma	Oligodendroglioma	BEFREE	11172594		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	11279269		★★★★★ ★☆☆☆☆ Found in Text Mining only
Androgen-Insensitivity Syndrome	Androgen-Insensitivity Syndrome	BEFREE	28117261		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	31046874		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	34944097	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	17082220, 17848581	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	40565357	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	28759611		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	9790756		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bedwetting	Nocturnal enuresis	BEFREE	9605876		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	17187396		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	30482227		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	11172594		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10490831, 12782580, 15647832, 17703868, 23125217, 24517997		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchioloalveolar Adenocarcinoma	Lung adenocarcinoma	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	28393206	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	10490831		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	35982895	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	30482227		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	12818433		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	15287022, 22073269, 23533274		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	27574806	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cat eye syndrome	Cat Eye Syndrome	BEFREE	11381032		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	14659882		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Oligodendroglioma	Oligodendroglioma	BEFREE	11172594		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	17621267		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholecystolithiasis	Cholecystolithiasis	BEFREE	29533266		★★★★★ ★☆☆☆☆ Found in Text Mining only
Choledocholithiasis	Choledocholithiasis	BEFREE	28668286		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholelithiasis	Cholelithiasis	BEFREE	29533266		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	9790756		★★★★★ ★☆☆☆☆ Found in Text Mining only
Clear-cell metastatic renal cell carcinoma	Renal Carcinoma	BEFREE	23982215		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	22157885, 30355787		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	34944097	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	15015574, 16772034		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	19446020, 23322277, 28186962, 29763718		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	23322277		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	18947387		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	23982215, 25815776, 27717821		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	21679057		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	28608149		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Stenosis	Coronary Stenosis	BEFREE	30338825		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	22157885, 26215868		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	GWASCAT_DG	26192919, 28067908		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	26215868, 28300425, 34944097	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	30338825		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	29224107		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	28724746		★★★★★ ★☆☆☆☆ Found in Text Mining only
DiGeorge Syndrome	DiGeorge Syndrome	BEFREE	9740669		★★★★★ ★☆☆☆☆ Found in Text Mining only
Disorder of eye	Disorder Of Eye	BEFREE	9615227		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	BEFREE	30322052		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial Neoplasms	LHGDN	17290588		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	BEFREE	27484038		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial Alzheimer Disease (FAD)	Alzheimer disease	BEFREE	9763673		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	26560698, 29381809		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fulminant hepatitis	Fulminant Hepatitis	BEFREE	31481966		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	16552434		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma, Primary Open Angle	Glaucoma	BEFREE	10873381		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gout	Gout	Pubtator	35813414	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatocellular Adenoma	Hepatocellular adenoma	BEFREE	26560698		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Multiple Exostoses	Multiple congenital exostosis	BEFREE	10878610		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	11932422		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	30463908	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	17410442		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	GWASCAT_DG	23128233, 28067908		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	GWASDB_DG	23128233		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	26215868, 34944097	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	9299237		★★★★★ ★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	Pubtator	36160033	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ki-1+ Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	BEFREE	21741362		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	15060005		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	31196660		★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal neoplasm	Laryngeal neoplasm	BEFREE	19212623		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	14576465, 26560698, 27835990		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	14576465, 26560698		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	15287022		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung Neoplasms	BEFREE	23533274, 26300007		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung neoplasms	Pubtator	37400148	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung Neoplasms	CTD_human_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphoma	Lymphoma	Pubtator	29504848	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10490831, 15647832, 17703868, 23125217, 24517997		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	15287022, 22073269, 23533274		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	CTD_human_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	17437806, 19396154, 19893039		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	30631034		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	12736707, 12851705, 15770218		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	25674762, 30481266		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	30482227		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10933042, 11472063, 11707285, 15015574, 15575964, 16103744, 16772034, 17192196, 17452638, 17584784, 18474104, 20813049, 23828905, 24998852, 25084127, 25815776, 27835990, 29485707 View all (3 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	15015574, 16772034		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	10490831, 11376935, 11948410, 16043716		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	18795070		★★★★★ ★☆☆☆☆ Found in Text Mining only
Marinesco-Sjogren syndrome	Marinesco-Sjogren Syndrome	BEFREE	23992855		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	14659882		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	21107320, 31186280, 31900433, 31980996, 37400148	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	30833747, 30904617, 31186280, 31498175		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	30338825		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Retardation	Mental retardation	BEFREE	9299237		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	29381809		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Respiratory Chain Deficiencies	Mitochondrial Respiratory Chain Deficiencies	BEFREE	10767177		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Endocrine Neoplasia Type 1	Multiple Endocrine Neoplasia	BEFREE	9205112		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	24723682		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	29485707		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	CTD_human_DG	16214533		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	11932422		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neck Neoplasms	Neck Neoplasms	BEFREE	19212623		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10092127, 10490831, 11264177, 12782580, 14586399, 14684992, 14719106, 15287022, 15575964, 15741768, 15885497, 16166425, 16552434, 16772034, 17621267 View all (11 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	Pubtator	15575964	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neutrophilia (disorder)	Neutrophilia	BEFREE	28694430		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	26560698, 29381809		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	28393206		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nonsyndromic Deafness	Nonsyndromic Deafness	BEFREE	8530067		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	19808894, 21346175, 21543429, 24586913		★★★★★ ★☆☆☆☆ Found in Text Mining only
oligodendroglioma	Oligodendroglioma	BEFREE	11172594		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	15305059		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	9737786		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papilloma	Papilloma	BEFREE	30631034		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	15575964	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Diseases	Vascular Diseases	BEFREE	31718197		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peritonitis	Peritonitis	Pubtator	37400148	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Peroxisome biogenesis disorders	Zellweger Syndrome	BEFREE	11405337		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	27001999		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	17437806, 19396154, 19893039		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	11254220		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	23982215, 25815776, 27717821		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	10331942, 28724746		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	15575964	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	23533274		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	12082567, 14966480, 15861775		★★★★★ ★☆☆☆☆ Found in Text Mining only
SCHIZOPHRENIA 1 (disorder)	Schizophrenia	BEFREE	12808430		★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	26259151		★★★★★ ★☆☆☆☆ Found in Text Mining only
Severe Acute Respiratory Syndrome	Severe Acute Respiratory Syndrome	BEFREE	21328370		★★★★★ ★☆☆☆☆ Found in Text Mining only
Severe autosomal recessive muscular dystrophy of childhood - North African type (disorder)	Muscular dystrophy	BEFREE	8530067		★★★★★ ★☆☆☆☆ Found in Text Mining only
Shprintzen-Goldberg syndrome	Shprintzen-Goldberg Syndrome	BEFREE	9740669		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	29504848	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin neoplasm	Pubtator	31719662	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	27503930, 30723988		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	36916400	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	8242620		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	26560698, 29381809		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	12736707, 12851705, 15770218		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	36768307	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	10490831, 15575964		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thymoma	Thymoma	BEFREE	16166425		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	25674762	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	2072910, 25674762, 30481266		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	30481266		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	37400148	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	22157885		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Well Differentiated Oligodendroglioma	Oligodendroglioma	BEFREE	11172594		★★★★★ ★☆☆☆☆ Found in Text Mining only

MAP3K8 (mitogen-activated protein kinase kinase kinase 8)