Gene Gene information from NCBI Gene database.
Entrez ID 132299
Gene name OCIA domain containing 2
Gene symbol OCIAD2
Synonyms (NCBI Gene)
-
Chromosome 4
Chromosome location 4p11
miRNA miRNA information provided by mirtarbase database.
451
miRTarBase ID miRNA Experiments Reference
MIRT023495 hsa-miR-1-3p Proteomics 18668040
MIRT049797 hsa-miR-92a-3p CLASH 23622248
MIRT623044 hsa-miR-8062 HITS-CLIP 23824327
MIRT655648 hsa-miR-6513-3p HITS-CLIP 23824327
MIRT623043 hsa-miR-936 HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
18
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 29743632
GO:0005739 Component Mitochondrion HTP 34800366
GO:0005739 Component Mitochondrion IDA 29743632
GO:0005739 Component Mitochondrion IEA
GO:0005743 Component Mitochondrial inner membrane IDA 35080992
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
619633 28685 ENSG00000145247
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q56VL3
Protein name OCIA domain-containing protein 2 (Ovarian carcinoma immunoreactive antigen-like protein)
Protein function Has an essential role in the assembly of mitochondrial respiratory chain complex III (PubMed:35080992). Is also required for STAT3 activation and plays a role in cell migration (PubMed:29743632). {ECO:0000269|PubMed:29743632, ECO:0000269|PubMed:
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07051 OCIA 31 117 Ovarian carcinoma immunoreactive antigen (OCIA) Family
Sequence
MASASARGNQDKDAHFPPPSKQSLLFCPKSKLHIHRAEISKIMRECQEESFWKRALPFSL
VSMLVTQGLVYQGYLAANSRFGSLPKVALAGLLGFGLGKVSYIGVCQSKFHFFEDQL
RGA
GFGPQHNRHCLLTCEECKIKHGLSEKGDSQPSAS
Sequence length 154
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
2
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
METABOLIC SYNDROME GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Adenocarcinoma Adenocarcinoma BEFREE 17054434, 30320419
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma of lung (disorder) Lung adenocarcinoma BEFREE 30320419
★☆☆☆☆
Found in Text Mining only
Androgen-Insensitivity Syndrome Androgen-Insensitivity Syndrome BEFREE 30320419
★☆☆☆☆
Found in Text Mining only
Bronchioloalveolar Adenocarcinoma Lung adenocarcinoma BEFREE 17054434
★☆☆☆☆
Found in Text Mining only
Carcinoma Hepatocellular Hepatocellular carcinoma Pubtator 28911005 Associate
★☆☆☆☆
Found in Text Mining only
Hepatoblastoma Hepatoblastoma Pubtator 26991471 Associate
★☆☆☆☆
Found in Text Mining only
Liver carcinoma Liver carcinoma BEFREE 28911005
★☆☆☆☆
Found in Text Mining only
Lymphatic Metastasis Lymphatic metastasis Pubtator 17054434 Associate
★☆☆☆☆
Found in Text Mining only
Malignant Neoplasms Malignant Neoplasm BEFREE 24949437
★☆☆☆☆
Found in Text Mining only
Neoplasms Neoplasms BEFREE 17054434, 28911005, 30320419
★☆☆☆☆
Found in Text Mining only