Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	132014
Gene name	Interleukin 17 receptor E
Gene symbol	IL17RE
Synonyms (NCBI Gene)	-
Chromosome	3
Chromosome location	3p25.3
Summary	This gene encodes a transmembrane protein that functions as the receptor for interleukin-17C. The encoded protein signals to downstream components of the mitogen activated protein kinase (MAPK) pathway. Activity of this protein is important in the immune

Show/Hide all (32)

miRTarBase ID	miRNA	Experiments
MIRT1064069	hsa-miR-1280	CLIP-seq
MIRT1064070	hsa-miR-133a	CLIP-seq
MIRT1064071	hsa-miR-133b	CLIP-seq
MIRT1064072	hsa-miR-3065-3p	CLIP-seq
MIRT1064073	hsa-miR-4281	CLIP-seq
MIRT1064074	hsa-miR-4286	CLIP-seq
MIRT1064075	hsa-miR-1180	CLIP-seq
MIRT1064070	hsa-miR-133a	CLIP-seq
MIRT1064071	hsa-miR-133b	CLIP-seq
MIRT1064076	hsa-miR-2277-5p	CLIP-seq
MIRT1064077	hsa-miR-3124-3p	CLIP-seq
MIRT1064078	hsa-miR-3126-5p	CLIP-seq
MIRT1064079	hsa-miR-3199	CLIP-seq
MIRT1064073	hsa-miR-4281	CLIP-seq
MIRT1064080	hsa-miR-4515	CLIP-seq
MIRT1064081	hsa-miR-4652-5p	CLIP-seq
MIRT1064082	hsa-miR-4664-3p	CLIP-seq
MIRT1064083	hsa-miR-4706	CLIP-seq
MIRT1064084	hsa-miR-4749-5p	CLIP-seq
MIRT1064085	hsa-miR-664	CLIP-seq
MIRT2015244	hsa-miR-361-3p	CLIP-seq
MIRT2247529	hsa-miR-1288	CLIP-seq
MIRT1064079	hsa-miR-3199	CLIP-seq
MIRT1064075	hsa-miR-1180	CLIP-seq
MIRT1064077	hsa-miR-3124-3p	CLIP-seq
MIRT1064074	hsa-miR-4286	CLIP-seq
MIRT1064082	hsa-miR-4664-3p	CLIP-seq
MIRT2451711	hsa-miR-511	CLIP-seq
MIRT1064085	hsa-miR-664	CLIP-seq
MIRT2465487	hsa-miR-3127-5p	CLIP-seq
MIRT2465488	hsa-miR-3167	CLIP-seq
MIRT2465489	hsa-miR-876-5p	CLIP-seq

Show/Hide all (10)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	21993848
GO:0005576	Component	Extracellular region	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006954	Process	Inflammatory response	IEA
GO:0016020	Component	Membrane	IEA
GO:0019221	Process	Cytokine-mediated signaling pathway	IEA
GO:0030368	Function	Interleukin-17 receptor activity	IBA
GO:0030368	Function	Interleukin-17 receptor activity	IEA

MIM	HGNC	e!Ensembl
614995	18439	ENSG00000163701

Q8NFR9

Protein name

Interleukin-17 receptor E (IL-17 receptor E) (IL-17RE)

Protein function

Specific functional receptor for IL17C. May be signaling through the NF-kappa-B and MAPK pathways. May require TRAF3IP2 /ACT1 for signaling. May be a crucial regulator in innate immunity to bacterial pathogens. Isoform 2 and isoform 4 may be eit

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF15037	IL17_R_N	39 → 448	Interleukin-17 receptor extracellular region	Family
PF08357	SEFIR	488 → 567	SEFIR domain	Family
PF08357	SEFIR	577 → 626	SEFIR domain	Family

Tissue specificity

TISSUE SPECIFICITY: Predominantly expressed in mucosal tissues with high levels in keratinocytes and colon epithelial cells. Very low expression in dermal fibroblasts. Expressed in various tumor cell lines. {ECO:0000269|PubMed:16310341, ECO:0000269|PubMed

Sequence

MGSSRLAALLLPLLLIVIDLSDSAGIGFRHLPHWNTRCPLASHTDDSFTGSSAYIPCRTW
WALFSTKPWCVRVWHCSRCLCQHLLSGGSGLQRGLFHLLVQKSKKSSTFKFYRRHKMPAP
AQRKLLPRRHLSEKSHHISIPSPDISHKGLRSKRTQPSDPETWESLPRLDSQRHGGPEFS
FDLLPEARAIRVTISSGPEVSVRLCHQWALECEELSSPYDVQKIVSGGHTVELPYEFLLP
CLCIEASYLQEDTVRRKKCPFQSWPEAYGSDFWKSVHFTDYSQHTQMVMALTLRCPLKLE
AALCQRHDWHTLCKDLPNATARESDGWYVLEKVDLHPQLCFKFSFGNSSHVECPHQTGSL
TSWNVSMDTQAQQLILHFSSRMHATFSAAWSLPGLGQDTLVPPVYTVSQARGSSPVSLDL
IIPFLRPGCCVLVWRSDVQFAWKHLLCPDVSYRHLGLLILALLALLTLLGVVLALTCRRP
QSGPGPARPVLLLHAADSEAQRRLVGALAELLRAALGGGRDVIVDLWEGRHVARVGPLPW
LWAARTRVAREQGTVLLLWSGADLRPVSGPDPRAAPLLALLHAAPRPLLLLAYFSRLCAK
GDIPPPLRALPRYRLLRDLPRLLRALDARPFAEATSWGRLGARQRRQSRLELCSRLEREA
ARLADLG

Sequence length

667

Interactions

View interactions

	KEGG		Reactome
	Cytokine-cytokine receptor interaction IL-17 signaling pathway		Interleukin-17 signaling

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CORNEAL NEOVASCULARIZATION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KERATITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (8)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Anemia	Anemia	BEFREE	24312262		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Chronic Hepatitis	Autoimmune hepatitis	BEFREE	27956525		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	29483158		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Adenoid Cystic	Adenoid cystic carcinoma	Pubtator	33162788	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	23305119	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	24325470		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	30356086		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	29483158		★★★★★ ★☆☆☆☆ Found in Text Mining only

IL17RE (interleukin 17 receptor E)