Gene Gene information from NCBI Gene database.
Entrez ID 131870
Gene name Nudix hydrolase 16
Gene symbol NUDT16
Synonyms (NCBI Gene)
-
Chromosome 3
Chromosome location 3q22.1
miRNA miRNA information provided by mirtarbase database.
630
miRTarBase ID miRNA Experiments Reference
MIRT040206 hsa-miR-615-3p CLASH 23622248
MIRT722751 hsa-miR-6865-3p HITS-CLIP 19536157
MIRT722750 hsa-miR-6890-3p HITS-CLIP 19536157
MIRT722749 hsa-miR-1273g-3p HITS-CLIP 19536157
MIRT722748 hsa-miR-5088-3p HITS-CLIP 19536157
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
45
GO ID Ontology Definition Evidence Reference
GO:0000166 Function Nucleotide binding IEA
GO:0000287 Function Magnesium ion binding IDA 17567574, 21337011, 29483298
GO:0003723 Function RNA binding IEA
GO:0003729 Function MRNA binding IDA 21337011
GO:0005634 Component Nucleus HDA 21630459
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
617381 26442 ENSG00000198585
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q96DE0
Protein name U8 snoRNA-decapping enzyme (EC 3.6.1.62) (IDP phosphatase) (IDPase) (EC 3.6.1.64) (Inosine diphosphate phosphatase) (Nucleoside diphosphate-linked moiety X motif 16) (Nudix motif 16) (Nudix hydrolase 16) (U8 snoRNA-binding protein H29K) (m7GpppN-mRNA hydr
Protein function RNA-binding and decapping enzyme that catalyzes the cleavage of the cap structure of snoRNAs and mRNAs in a metal-dependent manner. Part of the U8 snoRNP complex that is required for the accumulation of mature 5.8S and 28S rRNA. Has diphosphatas
PDB 2XSQ , 3COU , 3MGM , 5VY2 , 5W6X , 5W6Z , 5WJI , 6B09 , 6CO2 , 6X7U , 6X7V
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00293 NUDIX 34 142 NUDIX domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed strongly in lung, kidney, adrenal gland, testis, heart and brain. {ECO:0000269|PubMed:20385596}.
Sequence
MAGARRLELGEALALGSGWRHACHALLYAPDPGMLFGRIPLRYAILMQMRFDGRLGFPGG
FVDTQDRSLEDGLNRELREELGEAAAAFRVERTDYRSSHVGSGPRVVAHFYAKRLTLEEL
LAVEAGATRAKDHGLEVLGLVR
VPLYTLRDGVGGLPTFLENSFIGSAREQLLEALQDLGL
LQSGSISGLKIPAHH
Sequence length 195
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Purine metabolism
Metabolic pathways
Nucleotide metabolism
RNA degradation
  Phosphate bond hydrolysis by NUDT proteins
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
LIVER CIRRHOSIS, EXPERIMENTAL CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Heart Failure Heart failure Pubtator 36782329 Associate
★☆☆☆☆
Found in Text Mining only