Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	1318
Gene name	Solute carrier family 31 member 2
Gene symbol	SLC31A2
Synonyms (NCBI Gene)	COPT2CTR2hCTR2
Chromosome	9
Chromosome location	9q32

Show/Hide all (55)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022361	hsa-miR-124-3p	Microarray	18668037
MIRT1359900	hsa-miR-4529-5p	CLIP-seq
MIRT2106557	hsa-miR-3074-5p	CLIP-seq
MIRT2106558	hsa-miR-515-3p	CLIP-seq
MIRT2106559	hsa-miR-519e	CLIP-seq
MIRT2330834	hsa-miR-9	CLIP-seq
MIRT2625062	hsa-miR-1301	CLIP-seq
MIRT2625063	hsa-miR-214	CLIP-seq
MIRT2625064	hsa-miR-2355-5p	CLIP-seq
MIRT2625065	hsa-miR-28-3p	CLIP-seq
MIRT2625066	hsa-miR-3121-3p	CLIP-seq
MIRT2625067	hsa-miR-3123	CLIP-seq
MIRT2625068	hsa-miR-3619-5p	CLIP-seq
MIRT2625069	hsa-miR-3679-3p	CLIP-seq
MIRT2625070	hsa-miR-3925-5p	CLIP-seq
MIRT2625071	hsa-miR-3976	CLIP-seq
MIRT2625072	hsa-miR-4286	CLIP-seq
MIRT2625073	hsa-miR-4291	CLIP-seq
MIRT2625074	hsa-miR-4301	CLIP-seq
MIRT2625075	hsa-miR-4477a	CLIP-seq
MIRT2625076	hsa-miR-4660	CLIP-seq
MIRT2625077	hsa-miR-4727-5p	CLIP-seq
MIRT2625078	hsa-miR-4768-5p	CLIP-seq
MIRT2625079	hsa-miR-4769-3p	CLIP-seq
MIRT2625080	hsa-miR-5047	CLIP-seq
MIRT2625081	hsa-miR-544	CLIP-seq
MIRT2625082	hsa-miR-668	CLIP-seq
MIRT2625083	hsa-miR-761	CLIP-seq
MIRT2625084	hsa-miR-922	CLIP-seq
MIRT2691123	hsa-miR-208a	CLIP-seq
MIRT2691124	hsa-miR-208b	CLIP-seq
MIRT2625063	hsa-miR-214	CLIP-seq
MIRT2625064	hsa-miR-2355-5p	CLIP-seq
MIRT2625065	hsa-miR-28-3p	CLIP-seq
MIRT2625066	hsa-miR-3121-3p	CLIP-seq
MIRT2625067	hsa-miR-3123	CLIP-seq
MIRT2625068	hsa-miR-3619-5p	CLIP-seq
MIRT2625069	hsa-miR-3679-3p	CLIP-seq
MIRT2625070	hsa-miR-3925-5p	CLIP-seq
MIRT2625071	hsa-miR-3976	CLIP-seq
MIRT2625072	hsa-miR-4286	CLIP-seq
MIRT2625073	hsa-miR-4291	CLIP-seq
MIRT2625074	hsa-miR-4301	CLIP-seq
MIRT2625075	hsa-miR-4477a	CLIP-seq
MIRT2625077	hsa-miR-4727-5p	CLIP-seq
MIRT2625078	hsa-miR-4768-5p	CLIP-seq
MIRT2625079	hsa-miR-4769-3p	CLIP-seq
MIRT2691125	hsa-miR-499-5p	CLIP-seq
MIRT2625081	hsa-miR-544	CLIP-seq
MIRT2691126	hsa-miR-626	CLIP-seq
MIRT2691127	hsa-miR-646	CLIP-seq
MIRT2625082	hsa-miR-668	CLIP-seq
MIRT2625083	hsa-miR-761	CLIP-seq
MIRT2330834	hsa-miR-9	CLIP-seq
MIRT2625084	hsa-miR-922	CLIP-seq

Show/Hide all (25)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005375	Function	Copper ion transmembrane transporter activity	IDA	17617060, 17944601
GO:0005375	Function	Copper ion transmembrane transporter activity	IEA
GO:0005375	Function	Copper ion transmembrane transporter activity	TAS	9207117
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005764	Component	Lysosome	IEA
GO:0005765	Component	Lysosomal membrane	IDA	17617060
GO:0005765	Component	Lysosomal membrane	IEA
GO:0005768	Component	Endosome	IEA
GO:0005770	Component	Late endosome	IEA
GO:0005886	Component	Plasma membrane	IDA	17944601
GO:0005886	Component	Plasma membrane	TAS	9207117
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006825	Process	Copper ion transport	IDA	17617060
GO:0006825	Process	Copper ion transport	IEA
GO:0006825	Process	Copper ion transport	TAS	9207117
GO:0006878	Process	Intracellular copper ion homeostasis	IEA
GO:0015677	Process	Copper ion import	IDA	17944601
GO:0016020	Component	Membrane	IEA
GO:0030659	Component	Cytoplasmic vesicle membrane	IEA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0031902	Component	Late endosome membrane	IDA	17617060
GO:0031902	Component	Late endosome membrane	IEA
GO:0035434	Process	Copper ion transmembrane transport	IEA
GO:0055037	Component	Recycling endosome	IEA
GO:1902311	Process	Regulation of copper ion transmembrane transport	IEA

MIM	HGNC	e!Ensembl
603088	11017	ENSG00000136867

O15432

Protein name

Protein SLC31A2 (Copper transporter 2) (hCTR2) (Solute carrier family 31 member 2)

Protein function

Does not function as a copper(1+) importer in vivo (By similarity). However, in vitro functions as a low-affinity copper(1+) importer (PubMed:17617060, PubMed:17944601). Regulator of SLC31A1 which facilitates the cleavage of the SLC31A1 ecto-dom

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF04145	Ctr	1 → 136	Ctr copper transporter family	Family

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous with high expression in placenta and heart. {ECO:0000269|PubMed:17944601, ECO:0000269|PubMed:9207117}.

Sequence

MAMHFIFSDTAVLLFDFWSVHSPAGMALSVLVLLLLAVLYEGIKVGKAKLLNQVLVNLPT
SISQQTIAETDGDSAGSDSFPVGRTHHRWYLCHFGQSLIHVIQVVIGYFIMLAVMSYNTW
IFLGVVLGSAVGYYLAYPLLSTA

Sequence length

143

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BREAST CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (12)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Atherosclerosis	Atherosclerosis	Pubtator	37324184	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	38263039	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	33146201, 38538282	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	21570711		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatolenticular Degeneration	Hepatolenticular Degeneration	BEFREE	10425268		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatolenticular Degeneration	Hepatolenticular degeneration	Pubtator	35357466	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	21570711		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	24522273		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medullary carcinoma of thyroid	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	BEFREE	9510122		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	17714780		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	20194531		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	21570711		★★★★★ ★☆☆☆☆ Found in Text Mining only

SLC31A2 (solute carrier family 31 member 2)