Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Entrez ID	1316
Gene name	KLF transcription factor 6
Gene symbol	KLF6
Synonyms (NCBI Gene)	BCD1CBA1COPEBCPBPGBFPAC1ST12ZF9
Chromosome	10
Chromosome location	10p15.2
Summary	This gene encodes a member of the Kruppel-like family of transcription factors. The zinc finger protein is a transcriptional activator, and functions as a tumor suppressor. Multiple transcript variants encoding different isoforms have been found for this

Show/Hide all (6)

SNP ID	Visualize variation	Clinical significance	Consequence
rs121909139	A>G	Pathogenic	Missense variant, non coding transcript variant, coding sequence variant
rs121909140	G>A,C,T	Pathogenic	Stop gained, missense variant, non coding transcript variant, coding sequence variant
rs121909141	G>T	Pathogenic	Missense variant, non coding transcript variant, coding sequence variant
rs121909142	A>G	Pathogenic	Missense variant, non coding transcript variant, coding sequence variant
rs121909143	A>G	Pathogenic	Missense variant, non coding transcript variant, coding sequence variant
rs121909144	G>A,T	Pathogenic	Synonymous variant, missense variant, non coding transcript variant, coding sequence variant

660

Show/Hide all (660)

miRTarBase ID	miRNA	Experiments	Reference
MIRT006939	hsa-miR-181a-5p	Luciferase reporter assayqRT-PCRWestern blot	22581522
MIRT006939	hsa-miR-181a-5p	Luciferase reporter assayqRT-PCRWestern blot	22581522
MIRT006939	hsa-miR-181a-5p	Luciferase reporter assayqRT-PCRWestern blot	22581522
MIRT006939	hsa-miR-181a-5p	Luciferase reporter assayqRT-PCRWestern blot	22581522
MIRT022229	hsa-miR-124-3p	Microarray	18668037
MIRT043589	hsa-miR-148b-3p	CLASH	23622248
MIRT053362	hsa-miR-9-5p	MicroarrayqRT-PCR	23798388
MIRT054869	hsa-miR-101-3p	ImmunofluorescenceqRT-PCR	24817606
MIRT006939	hsa-miR-181a-5p	Luciferase reporter assayqRT-PCRWestern blot	25182666
MIRT006939	hsa-miR-181a-5p	Luciferase reporter assayqRT-PCRWestern blot	25182666
MIRT006939	hsa-miR-181a-5p	Luciferase reporter assayqRT-PCRWestern blot	25182666
MIRT006939	hsa-miR-181a-5p	Luciferase reporter assayqRT-PCRWestern blot	25182666
MIRT022229	hsa-miR-124-3p	Luciferase reporter assay	24184980
MIRT022229	hsa-miR-124-3p	Luciferase reporter assay	24184980
MIRT022229	hsa-miR-124-3p	Luciferase reporter assay	24184980
MIRT022229	hsa-miR-124-3p	Luciferase reporter assay	24184980
MIRT330481	hsa-miR-181c-5p	MicroarrayqRT-PCR	24397367
MIRT437998	hsa-miR-15a-5p	MicroarrayqRT-PCR	24397367
MIRT437997	hsa-miR-20b-5p	MicroarrayqRT-PCR	24397367
MIRT006939	hsa-miR-181a-5p	Luciferase reporter assayqRT-PCRWestern blot	25182666
MIRT006939	hsa-miR-181a-5p	Luciferase reporter assayqRT-PCRWestern blot	25182666
MIRT006939	hsa-miR-181a-5p	Luciferase reporter assayqRT-PCRWestern blot	25182666
MIRT006939	hsa-miR-181a-5p	Luciferase reporter assayqRT-PCRWestern blot	25182666
MIRT022229	hsa-miR-124-3p	Luciferase reporter assay	24184980
MIRT022229	hsa-miR-124-3p	Luciferase reporter assay	24184980
MIRT022229	hsa-miR-124-3p	Luciferase reporter assay	24184980
MIRT022229	hsa-miR-124-3p	Luciferase reporter assay	24184980
MIRT330481	hsa-miR-181c-5p	MicroarrayqRT-PCR	24397367
MIRT437998	hsa-miR-15a-5p	MicroarrayqRT-PCR	24397367
MIRT437997	hsa-miR-20b-5p	MicroarrayqRT-PCR	24397367
MIRT623428	hsa-miR-6830-3p	HITS-CLIP	23824327
MIRT623427	hsa-miR-511-5p	HITS-CLIP	23824327
MIRT623426	hsa-miR-6885-3p	HITS-CLIP	23824327
MIRT623425	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT556783	hsa-miR-6835-3p	PAR-CLIP	21572407
MIRT556782	hsa-miR-4422	PAR-CLIP	21572407
MIRT556781	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT556780	hsa-miR-142-5p	PAR-CLIP	21572407
MIRT556779	hsa-miR-5590-3p	PAR-CLIP	21572407
MIRT230420	hsa-miR-410-3p	PAR-CLIP	21572407
MIRT556778	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT556777	hsa-miR-4717-3p	PAR-CLIP	21572407
MIRT556775	hsa-miR-223-5p	PAR-CLIP	21572407
MIRT556776	hsa-miR-6867-5p	PAR-CLIP	21572407
MIRT556774	hsa-miR-340-5p	PAR-CLIP	21572407
MIRT556773	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT485441	hsa-miR-130a-3p	PAR-CLIP	23592263
MIRT485440	hsa-miR-301a-3p	PAR-CLIP	23592263
MIRT485439	hsa-miR-130b-3p	PAR-CLIP	23592263
MIRT485438	hsa-miR-454-3p	PAR-CLIP	23592263
MIRT485437	hsa-miR-4295	PAR-CLIP	23592263
MIRT485436	hsa-miR-301b-3p	PAR-CLIP	23592263
MIRT485435	hsa-miR-3666	PAR-CLIP	23592263
MIRT485434	hsa-miR-152-3p	PAR-CLIP	23592263
MIRT043589	hsa-miR-148b-3p	PAR-CLIP	23592263
MIRT485432	hsa-miR-148a-3p	PAR-CLIP	23592263
MIRT485433	hsa-miR-4676-5p	PAR-CLIP	23592263
MIRT485431	hsa-miR-575	PAR-CLIP	23592263
MIRT485430	hsa-miR-1825	PAR-CLIP	23592263
MIRT474603	hsa-miR-3609	PAR-CLIP	23592263
MIRT474602	hsa-miR-548ah-5p	PAR-CLIP	23592263
MIRT474601	hsa-miR-106a-5p	PAR-CLIP	23592263
MIRT474599	hsa-miR-106b-5p	PAR-CLIP	23592263
MIRT474600	hsa-miR-17-5p	PAR-CLIP	23592263
MIRT474598	hsa-miR-20a-5p	PAR-CLIP	23592263
MIRT437997	hsa-miR-20b-5p	PAR-CLIP	23592263
MIRT474597	hsa-miR-519d-3p	PAR-CLIP	23592263
MIRT474596	hsa-miR-526b-3p	PAR-CLIP	23592263
MIRT474595	hsa-miR-93-5p	PAR-CLIP	23592263
MIRT262478	hsa-miR-4796-3p	PAR-CLIP	23592263
MIRT474594	hsa-miR-7-1-3p	PAR-CLIP	23592263
MIRT474593	hsa-miR-7-2-3p	PAR-CLIP	23592263
MIRT474592	hsa-miR-495-5p	PAR-CLIP	23592263
MIRT474591	hsa-miR-4423-5p	PAR-CLIP	23592263
MIRT474590	hsa-miR-653-5p	PAR-CLIP	23592263
MIRT474589	hsa-miR-4774-3p	PAR-CLIP	23592263
MIRT474588	hsa-miR-4524b-3p	PAR-CLIP	23592263
MIRT474586	hsa-miR-4501	PAR-CLIP	23592263
MIRT474587	hsa-miR-4305	PAR-CLIP	23592263
MIRT474585	hsa-miR-4738-3p	PAR-CLIP	23592263
MIRT474584	hsa-miR-190a-5p	PAR-CLIP	23592263
MIRT474583	hsa-miR-190b	PAR-CLIP	23592263
MIRT262501	hsa-miR-1271-3p	PAR-CLIP	23592263
MIRT262500	hsa-miR-550a-3-5p	PAR-CLIP	23592263
MIRT262499	hsa-miR-550a-5p	PAR-CLIP	23592263
MIRT474582	hsa-miR-550b-2-5p	PAR-CLIP	23592263
MIRT054869	hsa-miR-101-3p	qRT-PCRLuciferase reporter assayImmunoprecipitaionWestern blot	25230316
MIRT054869	hsa-miR-101-3p	qRT-PCRLuciferase reporter assayImmunoprecipitaionWestern blot	25230316
MIRT006939	hsa-miR-181a-5p	5.0	27673564
MIRT006939	hsa-miR-181a-5p	5.0	27673564
MIRT732772	hsa-miR-200b-5p	ELISALuciferase reporter assayWestern blotting	34078414
MIRT735722	hsa-miR-181a-3p	Western blottingImmunoprecipitaion (IP)qRT-PCRFlow cytometry	31897348
MIRT737266	hsa-miR-543	Luciferase reporter assayWestern blottingqRT-PCR	33042458
MIRT623428	hsa-miR-6830-3p	HITS-CLIP	23824327
MIRT623427	hsa-miR-511-5p	HITS-CLIP	23824327
MIRT623426	hsa-miR-6885-3p	HITS-CLIP	23824327
MIRT623425	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT556783	hsa-miR-6835-3p	PAR-CLIP	21572407
MIRT556782	hsa-miR-4422	PAR-CLIP	21572407
MIRT556781	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT556780	hsa-miR-142-5p	PAR-CLIP	21572407
MIRT556779	hsa-miR-5590-3p	PAR-CLIP	21572407
MIRT230420	hsa-miR-410-3p	PAR-CLIP	21572407
MIRT556778	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT556777	hsa-miR-4717-3p	PAR-CLIP	21572407
MIRT556775	hsa-miR-223-5p	PAR-CLIP	21572407
MIRT556776	hsa-miR-6867-5p	PAR-CLIP	21572407
MIRT556774	hsa-miR-340-5p	PAR-CLIP	21572407
MIRT556773	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT485441	hsa-miR-130a-3p	PAR-CLIP	23592263
MIRT485440	hsa-miR-301a-3p	PAR-CLIP	23592263
MIRT485439	hsa-miR-130b-3p	PAR-CLIP	23592263
MIRT485438	hsa-miR-454-3p	PAR-CLIP	23592263
MIRT485437	hsa-miR-4295	PAR-CLIP	23592263
MIRT485436	hsa-miR-301b-3p	PAR-CLIP	23592263
MIRT485435	hsa-miR-3666	PAR-CLIP	23592263
MIRT485434	hsa-miR-152-3p	PAR-CLIP	23592263
MIRT043589	hsa-miR-148b-3p	PAR-CLIP	23592263
MIRT485432	hsa-miR-148a-3p	PAR-CLIP	23592263
MIRT485433	hsa-miR-4676-5p	PAR-CLIP	23592263
MIRT485431	hsa-miR-575	PAR-CLIP	23592263
MIRT485430	hsa-miR-1825	PAR-CLIP	23592263
MIRT474603	hsa-miR-3609	PAR-CLIP	23592263
MIRT474602	hsa-miR-548ah-5p	PAR-CLIP	23592263
MIRT474601	hsa-miR-106a-5p	PAR-CLIP	23592263
MIRT474599	hsa-miR-106b-5p	PAR-CLIP	23592263
MIRT474600	hsa-miR-17-5p	PAR-CLIP	23592263
MIRT474598	hsa-miR-20a-5p	PAR-CLIP	23592263
MIRT437997	hsa-miR-20b-5p	PAR-CLIP	23592263
MIRT474597	hsa-miR-519d-3p	PAR-CLIP	23592263
MIRT474596	hsa-miR-526b-3p	PAR-CLIP	23592263
MIRT474595	hsa-miR-93-5p	PAR-CLIP	23592263
MIRT262478	hsa-miR-4796-3p	PAR-CLIP	23592263
MIRT474594	hsa-miR-7-1-3p	PAR-CLIP	23592263
MIRT474593	hsa-miR-7-2-3p	PAR-CLIP	23592263
MIRT474592	hsa-miR-495-5p	PAR-CLIP	23592263
MIRT474591	hsa-miR-4423-5p	PAR-CLIP	23592263
MIRT474590	hsa-miR-653-5p	PAR-CLIP	23592263
MIRT474589	hsa-miR-4774-3p	PAR-CLIP	23592263
MIRT474588	hsa-miR-4524b-3p	PAR-CLIP	23592263
MIRT474586	hsa-miR-4501	PAR-CLIP	23592263
MIRT474587	hsa-miR-4305	PAR-CLIP	23592263
MIRT474585	hsa-miR-4738-3p	PAR-CLIP	23592263
MIRT474584	hsa-miR-190a-5p	PAR-CLIP	23592263
MIRT474583	hsa-miR-190b	PAR-CLIP	23592263
MIRT262501	hsa-miR-1271-3p	PAR-CLIP	23592263
MIRT262500	hsa-miR-550a-3-5p	PAR-CLIP	23592263
MIRT262499	hsa-miR-550a-5p	PAR-CLIP	23592263
MIRT474582	hsa-miR-550b-2-5p	PAR-CLIP	23592263
MIRT474590	hsa-miR-653-5p	Luciferase reporter assayWestern blottingqRT-PCR	36605481
MIRT485434	hsa-miR-152-3p	Luciferase reporter assayWestern blottingqRT-PCR	34680020
MIRT485432	hsa-miR-148a-3p	Luciferase reporter assayWestern blottingqRT-PCRImmunohistochemistry (IHC)RNA-seqImmunofluorescenceFlow cytometry	35858897
MIRT756176	Hsa-miR-21-5p	Luciferase reporter assayWestern blottingELISA	38516774
MIRT756273	hsa-miR-200a-3p	Luciferase reporter assayWestern blottingqRT-PCR	37975481
MIRT1096671	hsa-miR-106a	CLIP-seq
MIRT1096672	hsa-miR-106b	CLIP-seq
MIRT1096673	hsa-miR-1284	CLIP-seq
MIRT1096674	hsa-miR-1287	CLIP-seq
MIRT1096675	hsa-miR-140-5p	CLIP-seq
MIRT1096676	hsa-miR-141	CLIP-seq
MIRT1096677	hsa-miR-1470	CLIP-seq
MIRT1096678	hsa-miR-17	CLIP-seq
MIRT1096679	hsa-miR-18a	CLIP-seq
MIRT1096680	hsa-miR-18b	CLIP-seq
MIRT1096681	hsa-miR-1912	CLIP-seq
MIRT1096682	hsa-miR-19a	CLIP-seq
MIRT1096683	hsa-miR-19b	CLIP-seq
MIRT1096684	hsa-miR-200a	CLIP-seq
MIRT1096685	hsa-miR-200b	CLIP-seq
MIRT1096686	hsa-miR-200c	CLIP-seq
MIRT1096687	hsa-miR-20a	CLIP-seq
MIRT1096688	hsa-miR-20b	CLIP-seq
MIRT1096689	hsa-miR-22	CLIP-seq
MIRT1096690	hsa-miR-25	CLIP-seq
MIRT1096691	hsa-miR-300	CLIP-seq
MIRT1096692	hsa-miR-3074-5p	CLIP-seq
MIRT1096693	hsa-miR-3130-5p	CLIP-seq
MIRT1096694	hsa-miR-3135b	CLIP-seq
MIRT1096695	hsa-miR-3148	CLIP-seq
MIRT1096696	hsa-miR-3166	CLIP-seq
MIRT1096697	hsa-miR-3180-5p	CLIP-seq
MIRT1096698	hsa-miR-32	CLIP-seq
MIRT1096699	hsa-miR-324-5p	CLIP-seq
MIRT1096700	hsa-miR-3545-5p	CLIP-seq
MIRT1096701	hsa-miR-363	CLIP-seq
MIRT1096702	hsa-miR-3650	CLIP-seq
MIRT1096703	hsa-miR-3660	CLIP-seq
MIRT1096704	hsa-miR-3667-3p	CLIP-seq
MIRT1096705	hsa-miR-367	CLIP-seq
MIRT1096706	hsa-miR-381	CLIP-seq
MIRT1096707	hsa-miR-3978	CLIP-seq
MIRT1096708	hsa-miR-4263	CLIP-seq
MIRT1096709	hsa-miR-429	CLIP-seq
MIRT1096710	hsa-miR-4323	CLIP-seq
MIRT1096711	hsa-miR-4460	CLIP-seq
MIRT1096712	hsa-miR-4482	CLIP-seq
MIRT1096713	hsa-miR-4495	CLIP-seq
MIRT1096714	hsa-miR-4521	CLIP-seq
MIRT1096715	hsa-miR-4526	CLIP-seq
MIRT1096716	hsa-miR-4640-3p	CLIP-seq
MIRT1096717	hsa-miR-4645-3p	CLIP-seq
MIRT1096718	hsa-miR-4659a-3p	CLIP-seq
MIRT1096719	hsa-miR-4659b-3p	CLIP-seq
MIRT1096720	hsa-miR-4666-3p	CLIP-seq
MIRT1096721	hsa-miR-4667-3p	CLIP-seq
MIRT1096722	hsa-miR-4690-3p	CLIP-seq
MIRT1096723	hsa-miR-4708-3p	CLIP-seq
MIRT1096724	hsa-miR-4727-3p	CLIP-seq
MIRT1096725	hsa-miR-4735-3p	CLIP-seq
MIRT1096726	hsa-miR-4758-3p	CLIP-seq
MIRT1096727	hsa-miR-4761-3p	CLIP-seq
MIRT1096728	hsa-miR-4771	CLIP-seq
MIRT1096729	hsa-miR-4796-5p	CLIP-seq
MIRT1096730	hsa-miR-514	CLIP-seq
MIRT1096731	hsa-miR-514b-3p	CLIP-seq
MIRT1096732	hsa-miR-519d	CLIP-seq
MIRT1096733	hsa-miR-539	CLIP-seq
MIRT1096734	hsa-miR-548a-3p	CLIP-seq
MIRT1096735	hsa-miR-548ae	CLIP-seq
MIRT1096736	hsa-miR-548ah	CLIP-seq
MIRT1096737	hsa-miR-548aj	CLIP-seq
MIRT1096738	hsa-miR-548am	CLIP-seq
MIRT1096739	hsa-miR-548e	CLIP-seq
MIRT1096740	hsa-miR-548f	CLIP-seq
MIRT1096741	hsa-miR-548t	CLIP-seq
MIRT1096742	hsa-miR-548x	CLIP-seq
MIRT1096743	hsa-miR-570	CLIP-seq
MIRT1096744	hsa-miR-576-5p	CLIP-seq
MIRT1096745	hsa-miR-587	CLIP-seq
MIRT1096746	hsa-miR-634	CLIP-seq
MIRT1096747	hsa-miR-642b	CLIP-seq
MIRT1096748	hsa-miR-653	CLIP-seq
MIRT1096749	hsa-miR-665	CLIP-seq
MIRT1096750	hsa-miR-7	CLIP-seq
MIRT1096751	hsa-miR-767-3p	CLIP-seq
MIRT1096752	hsa-miR-875-3p	CLIP-seq
MIRT1096753	hsa-miR-92a	CLIP-seq
MIRT1096754	hsa-miR-92b	CLIP-seq
MIRT1096755	hsa-miR-93	CLIP-seq
MIRT1096756	hsa-miR-1256	CLIP-seq
MIRT1096676	hsa-miR-141	CLIP-seq
MIRT1096684	hsa-miR-200a	CLIP-seq
MIRT1096757	hsa-miR-2115	CLIP-seq
MIRT1096692	hsa-miR-3074-5p	CLIP-seq
MIRT1096758	hsa-miR-3149	CLIP-seq
MIRT1096697	hsa-miR-3180-5p	CLIP-seq
MIRT1096759	hsa-miR-3613-3p	CLIP-seq
MIRT1096760	hsa-miR-3682-5p	CLIP-seq
MIRT1096761	hsa-miR-3924	CLIP-seq
MIRT1096708	hsa-miR-4263	CLIP-seq
MIRT1096714	hsa-miR-4521	CLIP-seq
MIRT1096718	hsa-miR-4659a-3p	CLIP-seq
MIRT1096719	hsa-miR-4659b-3p	CLIP-seq
MIRT1096727	hsa-miR-4761-3p	CLIP-seq
MIRT1096762	hsa-miR-513a-3p	CLIP-seq
MIRT1096763	hsa-miR-513a-5p	CLIP-seq
MIRT1096764	hsa-miR-515-5p	CLIP-seq
MIRT1096765	hsa-miR-516a-3p	CLIP-seq
MIRT1096745	hsa-miR-587	CLIP-seq
MIRT1096766	hsa-miR-630	CLIP-seq
MIRT1096749	hsa-miR-665	CLIP-seq
MIRT1096767	hsa-miR-1273e	CLIP-seq
MIRT1096768	hsa-miR-1304	CLIP-seq
MIRT1096769	hsa-miR-24	CLIP-seq
MIRT1096770	hsa-miR-2467-5p	CLIP-seq
MIRT1096771	hsa-miR-3188	CLIP-seq
MIRT1096772	hsa-miR-3671	CLIP-seq
MIRT1096773	hsa-miR-3975	CLIP-seq
MIRT1096774	hsa-miR-4540	CLIP-seq
MIRT1096775	hsa-miR-4729	CLIP-seq
MIRT1096776	hsa-miR-4760-3p	CLIP-seq
MIRT1096777	hsa-miR-485-5p	CLIP-seq
MIRT1096778	hsa-miR-548aa	CLIP-seq
MIRT1096779	hsa-miR-607	CLIP-seq
MIRT1096780	hsa-miR-935	CLIP-seq
MIRT1096689	hsa-miR-22	CLIP-seq
MIRT1096760	hsa-miR-3682-5p	CLIP-seq
MIRT1550588	hsa-miR-1183	CLIP-seq
MIRT1550589	hsa-miR-329	CLIP-seq
MIRT1550590	hsa-miR-362-3p	CLIP-seq
MIRT1550591	hsa-miR-3941	CLIP-seq
MIRT1096708	hsa-miR-4263	CLIP-seq
MIRT1096714	hsa-miR-4521	CLIP-seq
MIRT1550592	hsa-miR-4643	CLIP-seq
MIRT1096718	hsa-miR-4659a-3p	CLIP-seq
MIRT1096719	hsa-miR-4659b-3p	CLIP-seq
MIRT1550593	hsa-miR-466	CLIP-seq
MIRT1550594	hsa-miR-4719	CLIP-seq
MIRT1096727	hsa-miR-4761-3p	CLIP-seq
MIRT1550595	hsa-miR-4789-3p	CLIP-seq
MIRT1096764	hsa-miR-515-5p	CLIP-seq
MIRT1550596	hsa-miR-603	CLIP-seq
MIRT2026142	hsa-miR-1179	CLIP-seq
MIRT2026143	hsa-miR-1254	CLIP-seq
MIRT2026144	hsa-miR-130a	CLIP-seq
MIRT2026145	hsa-miR-130b	CLIP-seq
MIRT2026146	hsa-miR-148a	CLIP-seq
MIRT2026147	hsa-miR-148b	CLIP-seq
MIRT2026148	hsa-miR-152	CLIP-seq
MIRT2026149	hsa-miR-21	CLIP-seq
MIRT1096691	hsa-miR-300	CLIP-seq
MIRT2026150	hsa-miR-301a	CLIP-seq
MIRT2026151	hsa-miR-301b	CLIP-seq
MIRT2026152	hsa-miR-3116	CLIP-seq
MIRT1096696	hsa-miR-3166	CLIP-seq
MIRT1096697	hsa-miR-3180-5p	CLIP-seq
MIRT2026153	hsa-miR-338-3p	CLIP-seq
MIRT2026154	hsa-miR-361-3p	CLIP-seq
MIRT1096706	hsa-miR-381	CLIP-seq
MIRT1096708	hsa-miR-4263	CLIP-seq
MIRT2026155	hsa-miR-4310	CLIP-seq
MIRT1096714	hsa-miR-4521	CLIP-seq
MIRT2026156	hsa-miR-4530	CLIP-seq
MIRT2026157	hsa-miR-454	CLIP-seq
MIRT1096716	hsa-miR-4640-3p	CLIP-seq
MIRT2026158	hsa-miR-4652-3p	CLIP-seq
MIRT1096718	hsa-miR-4659a-3p	CLIP-seq
MIRT1096719	hsa-miR-4659b-3p	CLIP-seq
MIRT1096720	hsa-miR-4666-3p	CLIP-seq
MIRT1096727	hsa-miR-4761-3p	CLIP-seq
MIRT2026159	hsa-miR-4778-5p	CLIP-seq
MIRT1550595	hsa-miR-4789-3p	CLIP-seq
MIRT2026160	hsa-miR-4789-5p	CLIP-seq
MIRT1096764	hsa-miR-515-5p	CLIP-seq
MIRT2026161	hsa-miR-590-5p	CLIP-seq
MIRT2026162	hsa-miR-661	CLIP-seq
MIRT1096749	hsa-miR-665	CLIP-seq
MIRT2026163	hsa-miR-671-5p	CLIP-seq
MIRT1096682	hsa-miR-19a	CLIP-seq
MIRT1096683	hsa-miR-19b	CLIP-seq
MIRT2026164	hsa-miR-3155	CLIP-seq
MIRT2026165	hsa-miR-3155b	CLIP-seq
MIRT1096723	hsa-miR-4708-3p	CLIP-seq
MIRT2026166	hsa-miR-484	CLIP-seq
MIRT1096763	hsa-miR-513a-5p	CLIP-seq
MIRT2026167	hsa-miR-548c-3p	CLIP-seq
MIRT1550588	hsa-miR-1183	CLIP-seq
MIRT2257231	hsa-miR-1207-3p	CLIP-seq
MIRT2257232	hsa-miR-1262	CLIP-seq
MIRT1096677	hsa-miR-1470	CLIP-seq
MIRT2026146	hsa-miR-148a	CLIP-seq
MIRT2026147	hsa-miR-148b	CLIP-seq
MIRT2026148	hsa-miR-152	CLIP-seq
MIRT2257233	hsa-miR-185	CLIP-seq
MIRT1096681	hsa-miR-1912	CLIP-seq
MIRT2026149	hsa-miR-21	CLIP-seq
MIRT1096770	hsa-miR-2467-5p	CLIP-seq
MIRT1096691	hsa-miR-300	CLIP-seq
MIRT1096693	hsa-miR-3130-5p	CLIP-seq
MIRT1096695	hsa-miR-3148	CLIP-seq
MIRT2257234	hsa-miR-3175	CLIP-seq
MIRT1550589	hsa-miR-329	CLIP-seq
MIRT1550590	hsa-miR-362-3p	CLIP-seq
MIRT2257235	hsa-miR-377	CLIP-seq
MIRT1096706	hsa-miR-381	CLIP-seq
MIRT1550591	hsa-miR-3941	CLIP-seq
MIRT2257236	hsa-miR-3974	CLIP-seq
MIRT2257237	hsa-miR-421	CLIP-seq
MIRT2257238	hsa-miR-4286	CLIP-seq
MIRT2257239	hsa-miR-4287	CLIP-seq
MIRT2257240	hsa-miR-4306	CLIP-seq
MIRT2257241	hsa-miR-431	CLIP-seq
MIRT1096710	hsa-miR-4323	CLIP-seq
MIRT2257242	hsa-miR-4457	CLIP-seq
MIRT2257243	hsa-miR-4469	CLIP-seq
MIRT2257244	hsa-miR-4470	CLIP-seq
MIRT1096712	hsa-miR-4482	CLIP-seq
MIRT2026156	hsa-miR-4530	CLIP-seq
MIRT2257245	hsa-miR-4639-5p	CLIP-seq
MIRT1550592	hsa-miR-4643	CLIP-seq
MIRT2257246	hsa-miR-4644	CLIP-seq
MIRT2257247	hsa-miR-4645-5p	CLIP-seq
MIRT1550593	hsa-miR-466	CLIP-seq
MIRT1096720	hsa-miR-4666-3p	CLIP-seq
MIRT1096721	hsa-miR-4667-3p	CLIP-seq
MIRT2257248	hsa-miR-4672	CLIP-seq
MIRT2257249	hsa-miR-4673	CLIP-seq
MIRT2257250	hsa-miR-4685-3p	CLIP-seq
MIRT2257251	hsa-miR-4701-3p	CLIP-seq
MIRT2257252	hsa-miR-4709-5p	CLIP-seq
MIRT2257253	hsa-miR-4715-5p	CLIP-seq
MIRT2257254	hsa-miR-4716-3p	CLIP-seq
MIRT1550594	hsa-miR-4719	CLIP-seq
MIRT2257255	hsa-miR-4723-5p	CLIP-seq
MIRT2257256	hsa-miR-4731-3p	CLIP-seq
MIRT2257257	hsa-miR-4742-5p	CLIP-seq
MIRT2257258	hsa-miR-4757-5p	CLIP-seq
MIRT1096726	hsa-miR-4758-3p	CLIP-seq
MIRT1550595	hsa-miR-4789-3p	CLIP-seq
MIRT2026160	hsa-miR-4789-5p	CLIP-seq
MIRT2257259	hsa-miR-4801	CLIP-seq
MIRT2257260	hsa-miR-487a	CLIP-seq
MIRT2257261	hsa-miR-493	CLIP-seq
MIRT2257262	hsa-miR-505	CLIP-seq
MIRT2026161	hsa-miR-590-5p	CLIP-seq
MIRT1550596	hsa-miR-603	CLIP-seq
MIRT2257263	hsa-miR-646	CLIP-seq
MIRT2257264	hsa-miR-1324	CLIP-seq
MIRT2026146	hsa-miR-148a	CLIP-seq
MIRT2026147	hsa-miR-148b	CLIP-seq
MIRT2026148	hsa-miR-152	CLIP-seq
MIRT1096689	hsa-miR-22	CLIP-seq
MIRT1096690	hsa-miR-25	CLIP-seq
MIRT1096691	hsa-miR-300	CLIP-seq
MIRT1096698	hsa-miR-32	CLIP-seq
MIRT1096701	hsa-miR-363	CLIP-seq
MIRT1096705	hsa-miR-367	CLIP-seq
MIRT1096760	hsa-miR-3682-5p	CLIP-seq
MIRT1096706	hsa-miR-381	CLIP-seq
MIRT1096710	hsa-miR-4323	CLIP-seq
MIRT1096720	hsa-miR-4666-3p	CLIP-seq
MIRT2257248	hsa-miR-4672	CLIP-seq
MIRT2257265	hsa-miR-4717-5p	CLIP-seq
MIRT1096726	hsa-miR-4758-3p	CLIP-seq
MIRT2257266	hsa-miR-4781-3p	CLIP-seq
MIRT1550595	hsa-miR-4789-3p	CLIP-seq
MIRT2026160	hsa-miR-4789-5p	CLIP-seq
MIRT1096778	hsa-miR-548aa	CLIP-seq
MIRT1096766	hsa-miR-630	CLIP-seq
MIRT1096753	hsa-miR-92a	CLIP-seq
MIRT1096754	hsa-miR-92b	CLIP-seq
MIRT1096673	hsa-miR-1284	CLIP-seq
MIRT1096689	hsa-miR-22	CLIP-seq
MIRT1096770	hsa-miR-2467-5p	CLIP-seq
MIRT1096691	hsa-miR-300	CLIP-seq
MIRT1096702	hsa-miR-3650	CLIP-seq
MIRT1096706	hsa-miR-381	CLIP-seq
MIRT1096708	hsa-miR-4263	CLIP-seq
MIRT1096714	hsa-miR-4521	CLIP-seq
MIRT1096718	hsa-miR-4659a-3p	CLIP-seq
MIRT1096719	hsa-miR-4659b-3p	CLIP-seq
MIRT1096720	hsa-miR-4666-3p	CLIP-seq
MIRT2257254	hsa-miR-4716-3p	CLIP-seq
MIRT1096727	hsa-miR-4761-3p	CLIP-seq
MIRT1096763	hsa-miR-513a-5p	CLIP-seq
MIRT1096744	hsa-miR-576-5p	CLIP-seq
MIRT2430467	hsa-miR-181a	CLIP-seq
MIRT2430468	hsa-miR-181b	CLIP-seq
MIRT2430469	hsa-miR-181c	CLIP-seq
MIRT2430470	hsa-miR-181d	CLIP-seq
MIRT2430471	hsa-miR-323-3p	CLIP-seq
MIRT2430472	hsa-miR-323b-3p	CLIP-seq
MIRT1096759	hsa-miR-3613-3p	CLIP-seq
MIRT2430473	hsa-miR-410	CLIP-seq
MIRT2430474	hsa-miR-4262	CLIP-seq
MIRT2430475	hsa-miR-4503	CLIP-seq
MIRT2430476	hsa-miR-485-3p	CLIP-seq
MIRT2430477	hsa-miR-518a-5p	CLIP-seq
MIRT2430478	hsa-miR-527	CLIP-seq
MIRT2430479	hsa-miR-550a	CLIP-seq
MIRT1096745	hsa-miR-587	CLIP-seq
MIRT2430480	hsa-miR-606	CLIP-seq
MIRT1096677	hsa-miR-1470	CLIP-seq
MIRT2257233	hsa-miR-185	CLIP-seq
MIRT1096689	hsa-miR-22	CLIP-seq
MIRT1096770	hsa-miR-2467-5p	CLIP-seq
MIRT1096690	hsa-miR-25	CLIP-seq
MIRT2257234	hsa-miR-3175	CLIP-seq
MIRT1096698	hsa-miR-32	CLIP-seq
MIRT1096701	hsa-miR-363	CLIP-seq
MIRT1096705	hsa-miR-367	CLIP-seq
MIRT2257235	hsa-miR-377	CLIP-seq
MIRT2257238	hsa-miR-4286	CLIP-seq
MIRT2257239	hsa-miR-4287	CLIP-seq
MIRT2257240	hsa-miR-4306	CLIP-seq
MIRT2257243	hsa-miR-4469	CLIP-seq
MIRT2257246	hsa-miR-4644	CLIP-seq
MIRT1096721	hsa-miR-4667-3p	CLIP-seq
MIRT2257250	hsa-miR-4685-3p	CLIP-seq
MIRT2257254	hsa-miR-4716-3p	CLIP-seq
MIRT2257255	hsa-miR-4723-5p	CLIP-seq
MIRT1096747	hsa-miR-642b	CLIP-seq
MIRT1096753	hsa-miR-92a	CLIP-seq
MIRT1096754	hsa-miR-92b	CLIP-seq
MIRT1096697	hsa-miR-3180-5p	CLIP-seq
MIRT2452639	hsa-miR-3189-5p	CLIP-seq
MIRT1096708	hsa-miR-4263	CLIP-seq
MIRT1096714	hsa-miR-4521	CLIP-seq
MIRT2452640	hsa-miR-4641	CLIP-seq
MIRT1096718	hsa-miR-4659a-3p	CLIP-seq
MIRT1096719	hsa-miR-4659b-3p	CLIP-seq
MIRT1096726	hsa-miR-4758-3p	CLIP-seq
MIRT1096727	hsa-miR-4761-3p	CLIP-seq
MIRT2452641	hsa-miR-520a-5p	CLIP-seq
MIRT2452642	hsa-miR-525-5p	CLIP-seq
MIRT2026142	hsa-miR-1179	CLIP-seq
MIRT2558524	hsa-miR-1200	CLIP-seq
MIRT2257231	hsa-miR-1207-3p	CLIP-seq
MIRT2558525	hsa-miR-1237	CLIP-seq
MIRT2558526	hsa-miR-1248	CLIP-seq
MIRT2558527	hsa-miR-1252	CLIP-seq
MIRT2558528	hsa-miR-1260	CLIP-seq
MIRT2558529	hsa-miR-1260b	CLIP-seq
MIRT2257232	hsa-miR-1262	CLIP-seq
MIRT2558530	hsa-miR-1276	CLIP-seq
MIRT1096677	hsa-miR-1470	CLIP-seq
MIRT2430467	hsa-miR-181a	CLIP-seq
MIRT2430468	hsa-miR-181b	CLIP-seq
MIRT2430469	hsa-miR-181c	CLIP-seq
MIRT2430470	hsa-miR-181d	CLIP-seq
MIRT2257233	hsa-miR-185	CLIP-seq
MIRT2558531	hsa-miR-188-3p	CLIP-seq
MIRT2558532	hsa-miR-1914	CLIP-seq
MIRT1096689	hsa-miR-22	CLIP-seq
MIRT1096770	hsa-miR-2467-5p	CLIP-seq
MIRT1096690	hsa-miR-25	CLIP-seq
MIRT2558533	hsa-miR-3074-3p	CLIP-seq
MIRT1096695	hsa-miR-3148	CLIP-seq
MIRT2558534	hsa-miR-3156-3p	CLIP-seq
MIRT2558535	hsa-miR-3173-3p	CLIP-seq
MIRT2257234	hsa-miR-3175	CLIP-seq
MIRT2558536	hsa-miR-3189-3p	CLIP-seq
MIRT1096698	hsa-miR-32	CLIP-seq
MIRT2558537	hsa-miR-326	CLIP-seq
MIRT1550589	hsa-miR-329	CLIP-seq
MIRT2558538	hsa-miR-330-5p	CLIP-seq
MIRT2558539	hsa-miR-340	CLIP-seq
MIRT2558540	hsa-miR-3545-3p	CLIP-seq
MIRT2558541	hsa-miR-3611	CLIP-seq
MIRT1550590	hsa-miR-362-3p	CLIP-seq
MIRT1096701	hsa-miR-363	CLIP-seq
MIRT1096705	hsa-miR-367	CLIP-seq
MIRT1096772	hsa-miR-3671	CLIP-seq
MIRT2558542	hsa-miR-3686	CLIP-seq
MIRT2257235	hsa-miR-377	CLIP-seq
MIRT1550591	hsa-miR-3941	CLIP-seq
MIRT1096707	hsa-miR-3978	CLIP-seq
MIRT2430473	hsa-miR-410	CLIP-seq
MIRT2430474	hsa-miR-4262	CLIP-seq
MIRT1096708	hsa-miR-4263	CLIP-seq
MIRT2257238	hsa-miR-4286	CLIP-seq
MIRT2257239	hsa-miR-4287	CLIP-seq
MIRT2257240	hsa-miR-4306	CLIP-seq
MIRT2257241	hsa-miR-431	CLIP-seq
MIRT2558543	hsa-miR-4311	CLIP-seq
MIRT2558544	hsa-miR-4320	CLIP-seq
MIRT2558545	hsa-miR-4324	CLIP-seq
MIRT2558546	hsa-miR-4325	CLIP-seq
MIRT2257242	hsa-miR-4457	CLIP-seq
MIRT2257243	hsa-miR-4469	CLIP-seq
MIRT1096713	hsa-miR-4495	CLIP-seq
MIRT1096714	hsa-miR-4521	CLIP-seq
MIRT2026156	hsa-miR-4530	CLIP-seq
MIRT2558547	hsa-miR-4539	CLIP-seq
MIRT2558548	hsa-miR-4639-3p	CLIP-seq
MIRT2257245	hsa-miR-4639-5p	CLIP-seq
MIRT2257246	hsa-miR-4644	CLIP-seq
MIRT2026158	hsa-miR-4652-3p	CLIP-seq
MIRT1096718	hsa-miR-4659a-3p	CLIP-seq
MIRT1096719	hsa-miR-4659b-3p	CLIP-seq
MIRT1550593	hsa-miR-466	CLIP-seq
MIRT1096720	hsa-miR-4666-3p	CLIP-seq
MIRT1096721	hsa-miR-4667-3p	CLIP-seq
MIRT2558549	hsa-miR-4667-5p	CLIP-seq
MIRT2257248	hsa-miR-4672	CLIP-seq
MIRT2558550	hsa-miR-4682	CLIP-seq
MIRT2558551	hsa-miR-4684-3p	CLIP-seq
MIRT2257250	hsa-miR-4685-3p	CLIP-seq
MIRT2558552	hsa-miR-4685-5p	CLIP-seq
MIRT2558553	hsa-miR-4700-5p	CLIP-seq
MIRT2257251	hsa-miR-4701-3p	CLIP-seq
MIRT2257253	hsa-miR-4715-5p	CLIP-seq
MIRT2257254	hsa-miR-4716-3p	CLIP-seq
MIRT2257255	hsa-miR-4723-5p	CLIP-seq
MIRT2558554	hsa-miR-4742-3p	CLIP-seq
MIRT2558555	hsa-miR-4751	CLIP-seq
MIRT2257258	hsa-miR-4757-5p	CLIP-seq
MIRT1096776	hsa-miR-4760-3p	CLIP-seq
MIRT1096727	hsa-miR-4761-3p	CLIP-seq
MIRT2558556	hsa-miR-4793-3p	CLIP-seq
MIRT2257260	hsa-miR-487a	CLIP-seq
MIRT2558557	hsa-miR-500a	CLIP-seq
MIRT2558558	hsa-miR-511	CLIP-seq
MIRT1096764	hsa-miR-515-5p	CLIP-seq
MIRT2558559	hsa-miR-532-5p	CLIP-seq
MIRT2558560	hsa-miR-542-5p	CLIP-seq
MIRT2558561	hsa-miR-544b	CLIP-seq
MIRT1096734	hsa-miR-548a-3p	CLIP-seq
MIRT2558562	hsa-miR-548ad	CLIP-seq
MIRT1096739	hsa-miR-548e	CLIP-seq
MIRT1096740	hsa-miR-548f	CLIP-seq
MIRT2558563	hsa-miR-583	CLIP-seq
MIRT1096745	hsa-miR-587	CLIP-seq
MIRT1550596	hsa-miR-603	CLIP-seq
MIRT2430480	hsa-miR-606	CLIP-seq
MIRT1096779	hsa-miR-607	CLIP-seq
MIRT2558564	hsa-miR-615-5p	CLIP-seq
MIRT2558565	hsa-miR-637	CLIP-seq
MIRT1096747	hsa-miR-642b	CLIP-seq
MIRT2257263	hsa-miR-646	CLIP-seq
MIRT2558566	hsa-miR-654-3p	CLIP-seq
MIRT2558567	hsa-miR-662	CLIP-seq
MIRT2558568	hsa-miR-758	CLIP-seq
MIRT1096753	hsa-miR-92a	CLIP-seq
MIRT1096754	hsa-miR-92b	CLIP-seq
MIRT2558527	hsa-miR-1252	CLIP-seq
MIRT2558530	hsa-miR-1276	CLIP-seq
MIRT1096677	hsa-miR-1470	CLIP-seq
MIRT2430467	hsa-miR-181a	CLIP-seq
MIRT2430468	hsa-miR-181b	CLIP-seq
MIRT2430469	hsa-miR-181c	CLIP-seq
MIRT2430470	hsa-miR-181d	CLIP-seq
MIRT2257233	hsa-miR-185	CLIP-seq
MIRT2558532	hsa-miR-1914	CLIP-seq
MIRT1096689	hsa-miR-22	CLIP-seq
MIRT1096770	hsa-miR-2467-5p	CLIP-seq
MIRT1096690	hsa-miR-25	CLIP-seq
MIRT1096695	hsa-miR-3148	CLIP-seq
MIRT2558535	hsa-miR-3173-3p	CLIP-seq
MIRT2257234	hsa-miR-3175	CLIP-seq
MIRT1096698	hsa-miR-32	CLIP-seq
MIRT1550589	hsa-miR-329	CLIP-seq
MIRT2558541	hsa-miR-3611	CLIP-seq
MIRT1550590	hsa-miR-362-3p	CLIP-seq
MIRT1096701	hsa-miR-363	CLIP-seq
MIRT1096705	hsa-miR-367	CLIP-seq
MIRT2257235	hsa-miR-377	CLIP-seq
MIRT1550591	hsa-miR-3941	CLIP-seq
MIRT2430474	hsa-miR-4262	CLIP-seq
MIRT2257238	hsa-miR-4286	CLIP-seq
MIRT2257239	hsa-miR-4287	CLIP-seq
MIRT2257240	hsa-miR-4306	CLIP-seq
MIRT2257241	hsa-miR-431	CLIP-seq
MIRT2558543	hsa-miR-4311	CLIP-seq
MIRT2558546	hsa-miR-4325	CLIP-seq
MIRT2257242	hsa-miR-4457	CLIP-seq
MIRT2257243	hsa-miR-4469	CLIP-seq
MIRT1096713	hsa-miR-4495	CLIP-seq
MIRT2558548	hsa-miR-4639-3p	CLIP-seq
MIRT2257245	hsa-miR-4639-5p	CLIP-seq
MIRT2257246	hsa-miR-4644	CLIP-seq
MIRT1550593	hsa-miR-466	CLIP-seq
MIRT1096721	hsa-miR-4667-3p	CLIP-seq
MIRT2257248	hsa-miR-4672	CLIP-seq
MIRT2558551	hsa-miR-4684-3p	CLIP-seq
MIRT2257250	hsa-miR-4685-3p	CLIP-seq
MIRT2558552	hsa-miR-4685-5p	CLIP-seq
MIRT2257253	hsa-miR-4715-5p	CLIP-seq
MIRT2257254	hsa-miR-4716-3p	CLIP-seq
MIRT2257255	hsa-miR-4723-5p	CLIP-seq
MIRT2558555	hsa-miR-4751	CLIP-seq
MIRT2257258	hsa-miR-4757-5p	CLIP-seq
MIRT2558556	hsa-miR-4793-3p	CLIP-seq
MIRT2257260	hsa-miR-487a	CLIP-seq
MIRT2558557	hsa-miR-500a	CLIP-seq
MIRT2558558	hsa-miR-511	CLIP-seq
MIRT2558559	hsa-miR-532-5p	CLIP-seq
MIRT1096734	hsa-miR-548a-3p	CLIP-seq
MIRT2558562	hsa-miR-548ad	CLIP-seq
MIRT1096739	hsa-miR-548e	CLIP-seq
MIRT1096740	hsa-miR-548f	CLIP-seq
MIRT2558563	hsa-miR-583	CLIP-seq
MIRT1096745	hsa-miR-587	CLIP-seq
MIRT1550596	hsa-miR-603	CLIP-seq
MIRT2430480	hsa-miR-606	CLIP-seq
MIRT1096747	hsa-miR-642b	CLIP-seq
MIRT2558566	hsa-miR-654-3p	CLIP-seq
MIRT2558568	hsa-miR-758	CLIP-seq
MIRT1096753	hsa-miR-92a	CLIP-seq
MIRT1096754	hsa-miR-92b	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
NR1I2	Activation	21072196

Show/Hide all (23)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	18755691
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	18755691
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA
GO:0001650	Component	Fibrillar center	IDA
GO:0003677	Function	DNA binding	IEA
GO:0005515	Function	Protein binding	IPI	24634218, 32814053, 33227311
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	TAS	9689109
GO:0005654	Component	Nucleoplasm	IDA
GO:0005730	Component	Nucleolus	IDA
GO:0005829	Component	Cytosol	IDA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0008270	Function	Zinc ion binding	IEA
GO:0030183	Process	B cell differentiation	NAS	9000136
GO:0045893	Process	Positive regulation of DNA-templated transcription	TAS	9083102, 9689109
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	18755691
GO:0046872	Function	Metal ion binding	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

MIM	HGNC	e!Ensembl
602053	2235	ENSG00000067082

Q99612

Protein name

Krueppel-like factor 6 (B-cell-derived protein 1) (Core promoter element-binding protein) (GC-rich sites-binding factor GBF) (Proto-oncogene BCD1) (Suppressor of tumorigenicity 12 protein) (Transcription factor Zf9)

Protein function

Transcriptional activator (By similarity). Binds a GC box motif. Could play a role in B-cell growth and development.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00096	zf-C2H2	200 → 224	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	230 → 254	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	260 → 282	Zinc finger, C2H2 type	Domain

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in placenta followed by spleen, thymus, prostate, testis, small intestine and colon. Weakly expressed in pancreas, lung, liver, heart and skeletal muscle. Also expressed in fetal brain, spleen and thymus.

Sequence

MDVLPMCSIFQELQIVHETGYFSALPSLEEYWQQTCLELERYLQSEPCYVSASEIKFDSQ
EDLWTKIILAREKKEESELKISSSPPEDTLISPSFCYNLETNSLNSDVSSESSDSSEELS
PTAKFTSDPIGEVLVSSGKLSSSVTSTPPSSPELSREPSQLWGCVPGELPSPGKVRSGTS
GKPGDKGNGDASPDGRRRVHRCHFNGCRKVYTKSSHLKAHQRTHTGEKPYRCSWEGCEWR
FARSDELTRHFRKHTGAKPFKCSHCDRCFSRSDHLALHMKRHL

Sequence length

283

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (2)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Gastric cancer	Pathogenic	rs121909144	RCV000008010	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Prostate cancer, somatic	Pathogenic	rs121909139, rs121909140, rs121909141, rs121909142, rs121909143	RCV000008005 RCV000008006 RCV000008007 RCV000008008 RCV000008009	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (18)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ANDROGENETIC ALOPECIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypotension	not provided; Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of urinary bladder	-	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	-	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGODENDROGLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN SEROUS CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	HPO	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RESTLESS LEGS SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SARCOIDOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SPORADIC AMYOTROPHIC LATERAL SCLEROSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STOMACH NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (212)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute leukemia	Leukemia	BEFREE	10339498		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	31776270		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	16856969, 30310314, 31788045		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	18250346		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	18250346, 22653055		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of prostate	Prostate adenocarcinoma	BEFREE	8637912		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of prostate	Prostate adenocarcinoma	CGI_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	17347589		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aggressive Periodontitis	Aggressive Periodontitis	BEFREE	11762875		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplastic astrocytoma	Anaplastic Astrocytoma	BEFREE	12740910		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	30638935		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	23972788		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	23972788		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	37975481	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	12740910, 15172991, 16044160		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	LHGDN	12740910		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	24819318	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	30571484		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	26658105		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign neoplasm of stomach	Benign Neoplasm Of Stomach	CGI_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	16888207, 17125911		★★★★★ ★☆☆☆☆ Found in Text Mining only
beta Thalassemia	Beta thalassemia	Pubtator	33368182	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	19958095		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone neoplasms	Bone neoplasms	BEFREE	22855058		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	10867818, 17143513, 30859090		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	LHGDN	17143513		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	14742913, 19707857, 20126619, 23345610, 24519062		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	18053161, 20126619, 27629257	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	24519062	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	31326577		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	16610031, 24921656	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	15247715, 16702959		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	34524611	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	20126619	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal Breast	Ductal carcinoma of breast	Pubtator	20126619	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	16972326, 17196295, 22859706, 23085750, 24921656	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	18471523	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma in situ of stomach	Stomach Carcinoma	CGI_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	11193832, 12409225, 17223258, 18250346, 30590988		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	18719336, 29101805, 37047421, 40500522	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	36056909	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	16778100, 19097929, 30206992, 30964160		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Pancreatic Ductal	Pancreatic Ductal Carcinoma	BEFREE	31788045		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	24184689		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	24184689, 39215680	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carotid Atherosclerosis	Carotid Atherosclerosis	BEFREE	30763823		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	Pubtator	37159192	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	23628440		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	25119587		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	25119587, 29152072		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	25538042, 29432497		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic myeloproliferative disorder	Myeloproliferative disorder	BEFREE	31792942		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	30182733		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	18171345		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	29526016		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	14742913		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	14742913		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	14503916, 15057748, 16044160, 16610031, 16856969, 17663506, 21829229, 29084019, 31650732		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	15057748, 16044160, 16856969, 17663506		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	16610031, 17663506, 21829229, 23085750, 29084019	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	17347589		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Hydrocephalus	Congenital Hydrocephalus	BEFREE	16823482		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	28392470		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	27780824, 29066014, 29101805, 30858363		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	37432109	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	21109018		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	19808645, 21109018		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	24397367	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	LHGDN	18753303		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	19808645, 30115650		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ductal Carcinoma	Ductal Carcinoma	BEFREE	20126619		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	16778100		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	31696474		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	10802067, 31696474	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	28188753	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial lichen amyloidosis	Lichen amyloidosis	BEFREE	23219426		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	LHGDN	18515091		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty liver	Pubtator	18515091	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	23353867		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	28864835		★★★★★ ★☆☆☆☆ Found in Text Mining only
Focal glomerulosclerosis	Glomerulosclerosis	BEFREE	25689250		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	12740910, 20545576, 25230316, 27900577, 28166199, 29113289		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	28166199	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	15064720, 17514651, 20545576, 21555372, 25230316, 27900577, 28166199, 29113289		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	10867818, 20545576, 29113289, 30859090, 31210314		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	31210314, 37439825	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	CGI_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	28713898	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hearing Loss, Mixed Conductive-Sensorineural	Hearing Loss	BEFREE	28950053, 29450971		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	28392470		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	24519062	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Diffuse Gastric Cancer	Gastric Cancer	CTD_human_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Nonpolyposis Colorectal Cancer	Colorectal Cancer	BEFREE	17347589		★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	29526016		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hydrocephalus	Hydrocephalus	BEFREE	16823490		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	19581838		★★★★★ ★☆☆☆☆ Found in Text Mining only
hypertensive nephropathy	Hypertensive Nephropathy	BEFREE	28713898		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive Nephropathy	Hypertensive nephropathy	Pubtator	28713898	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypospadias	Hypospadias	BEFREE	24986825		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypospadias	Hypospadias	Pubtator	24986825	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	39215680, 40500522	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	19581838		★★★★★ ★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	28713898		★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	29526016		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	15057748		★★★★★ ★☆☆☆☆ Found in Text Mining only
Interstitial Cystitis	Interstitial Cystitis	BEFREE	30259317		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial aneurysm	Pubtator	39215680	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	BEFREE	16431954		★★★★★ ★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	LHGDN	16431954, 17893646		★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	35756421	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	29432497, 31085557	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	38462943	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	23977008, 31085557, 38462943	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Large Granular Lymphocytic	Lymphoblastic Leukemia	BEFREE	14680939		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	21470678, 24130502		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	28638268		★★★★★ ★☆☆☆☆ Found in Text Mining only
liposarcoma	Liposarcoma	BEFREE	26193637		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liposarcoma	Liposarcoma	Pubtator	26193637	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	15486921, 16044160, 16872311, 16972326, 17196295, 17347668, 17550140, 18171345, 18471523, 20116377, 20801538, 21563203, 22535637, 22859706, 23085750 View all (4 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	15486921, 16872311, 16972326, 17347668		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	18171345		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure, Acute	Liver failure	BEFREE	28808340		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	17550140, 21563203		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	17223258		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	18250346	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	19333010	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	16610031, 24366496	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	35048637, 37955538	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of brain	Brain Neoplasms	BEFREE	30859090		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	14742913, 19707857, 20126619, 23345610, 24519062		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	18719336		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	11193832, 12409225, 17143513, 17223258, 18250346, 30590988		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	28638268		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	16778100, 19097929, 30206992, 30964160		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	11752579, 12651626, 12740910, 12915879, 14503916, 15057748, 15064720, 15172991, 15247715, 15735005, 15994951, 16044160, 16230382, 16267836, 16372333 View all (13 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	15824733, 18190240, 21309496, 21538018, 22581522, 30628682		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	CGI_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	CTD_human_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	15486921, 16019382, 16230382, 16598737, 17113081, 17143513, 17514651, 18190240, 18250346, 18719336, 19097929, 21147133, 21154818, 21309496, 21538018 View all (10 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	25119587		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	14742913		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	16019382, 24519062		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	18053161		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	26658105		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	20660366		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Melanoma	Pubtator	24366496	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma Cutaneous Malignant	Melanoma	Pubtator	24366496, 37955538	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	35048637	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	30859090		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	24220567		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	31284862		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	20660366		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	18596922		★★★★★ ★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	BEFREE	20974589, 22766684, 28776455, 29500688, 30799680		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	28638268	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	24030118, 26257207, 29432497		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	14503916, 29854578		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	22260379	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11752579, 12651626, 12740910, 12915879, 14732919, 15057748, 15064720, 15172991, 15486921, 15735005, 15824733, 15994951, 16044160, 16230382, 16510604 View all (62 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	16226889, 17995938, 19269029		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodevelopmental Disorders	Neurodevelopmental Disorders	BEFREE	24220567		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	16888199		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	18515091, 22095588, 31255630, 31388695		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	15172991, 26261507, 30210914, 30310314, 31632477		★★★★★ ★☆☆☆☆ Found in Text Mining only
NONAKA MYOPATHY	Inclusion body myopathy	BEFREE	30022438		★★★★★ ★☆☆☆☆ Found in Text Mining only
oligodendroglioma	Oligodendroglioma	BEFREE	10867818, 12740910		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteosarcoma	Osteosarcoma	BEFREE	22855058, 23322324		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	22855058, 23322324	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	33506896	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	16778100, 19097929, 30206992, 30964160		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	16778100		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	28407786	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	19006382		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	18691883	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	27566169		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	29704474		★★★★★ ★☆☆☆☆ Found in Text Mining only
Penile hypospadias	Penile Hypospadias	BEFREE	24986825		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	33955459	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
POPLITEAL PTERYGIUM SYNDROME, LETHAL TYPE	Bartsocas-Papas syndrome	BEFREE	30259317		★★★★★ ★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	21350482, 25680674		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate cancer, familial	Prostate cancer	BEFREE	15247715, 16267836, 29970714		★★★★★ ★☆☆☆☆ Found in Text Mining only
PROSTATE CANCER, SOMATIC	Prostate Cancer	CLINVAR_DG			★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Prostate carcinoma	Prostate cancer	BEFREE	11752579, 12651626, 12740910, 12915879, 15057748, 15064720, 15172991, 15247715, 15735005, 15994951, 16230382, 16267836, 16372333, 16598737, 16888207 View all (11 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	11752579, 18190704, 19020536, 22782870		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	11752579, 12651597, 12651626, 15067324, 15247715, 16598737, 17125911, 18596922, 18719336, 18755691, 19020536		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	12915879, 16972326, 18190704, 18755691, 19020536, 21282102, 22277651, 23219426, 26011342	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	22819534	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	Pubtator	24267790	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	18719336, 30858363		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	18719336, 30858363		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	10583729, 11166332, 31723124		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	30524940		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	17387318, 19958095, 27383213, 28125634		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous cell carcinoma	Carcinoma	BEFREE	30310314		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	28188753		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	27035117	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	17621627, 27035117		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	18515091, 23353867		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	15824733, 18190240, 21309496, 21538018, 22581522, 30628682		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	CGI_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	15824733		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach neoplasms	Pubtator	21309496, 22581522	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach Neoplasms	CGI_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach Neoplasms	CLINVAR_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach Neoplasms	CTD_human_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Tendinopathy	Tendinopathy	BEFREE	29807011		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	25119587, 35112985	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Well Differentiated Oligodendroglioma	Oligodendroglioma	BEFREE	10867818, 12740910		★★★★★ ★☆☆☆☆ Found in Text Mining only

KLF6 (KLF transcription factor 6)