Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	131540
Gene name	ZDHHC palmitoyltransferase 19
Gene symbol	ZDHHC19
Synonyms (NCBI Gene)	DHHC19
Chromosome	3
Chromosome location	3q29

Show/Hide all (40)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018372	hsa-miR-335-5p	Microarray	18185580
MIRT1507967	hsa-miR-124	CLIP-seq
MIRT1507968	hsa-miR-1266	CLIP-seq
MIRT1507969	hsa-miR-2115	CLIP-seq
MIRT1507970	hsa-miR-3127-5p	CLIP-seq
MIRT1507971	hsa-miR-3173-3p	CLIP-seq
MIRT1507972	hsa-miR-3612	CLIP-seq
MIRT1507973	hsa-miR-3664-3p	CLIP-seq
MIRT1507974	hsa-miR-3689a-3p	CLIP-seq
MIRT1507975	hsa-miR-3689c	CLIP-seq
MIRT1507976	hsa-miR-3918	CLIP-seq
MIRT1507977	hsa-miR-4428	CLIP-seq
MIRT1507978	hsa-miR-4436b-5p	CLIP-seq
MIRT1507979	hsa-miR-4518	CLIP-seq
MIRT1507980	hsa-miR-4695-5p	CLIP-seq
MIRT1507981	hsa-miR-4728-5p	CLIP-seq
MIRT1507982	hsa-miR-4795-5p	CLIP-seq
MIRT1507983	hsa-miR-506	CLIP-seq
MIRT1507984	hsa-miR-510	CLIP-seq
MIRT1507985	hsa-miR-650	CLIP-seq
MIRT1507986	hsa-miR-873	CLIP-seq
MIRT2397303	hsa-miR-103a	CLIP-seq
MIRT2397304	hsa-miR-107	CLIP-seq
MIRT2397305	hsa-miR-1184	CLIP-seq
MIRT2397306	hsa-miR-15a	CLIP-seq
MIRT2397307	hsa-miR-15b	CLIP-seq
MIRT2397308	hsa-miR-16	CLIP-seq
MIRT2397309	hsa-miR-1909	CLIP-seq
MIRT2397310	hsa-miR-195	CLIP-seq
MIRT2397311	hsa-miR-1976	CLIP-seq
MIRT2397312	hsa-miR-214	CLIP-seq
MIRT2397313	hsa-miR-3619-5p	CLIP-seq
MIRT2397314	hsa-miR-424	CLIP-seq
MIRT2397315	hsa-miR-4283	CLIP-seq
MIRT2397316	hsa-miR-4488	CLIP-seq
MIRT2397317	hsa-miR-4697-5p	CLIP-seq
MIRT2397318	hsa-miR-497	CLIP-seq
MIRT2397319	hsa-miR-637	CLIP-seq
MIRT2397320	hsa-miR-661	CLIP-seq
MIRT2397321	hsa-miR-761	CLIP-seq

Show/Hide all (22)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IDA	20074548
GO:0000139	Component	Golgi membrane	IEA
GO:0005515	Function	Protein binding	IPI	32814053
GO:0005737	Component	Cytoplasm	IEA
GO:0005783	Component	Endoplasmic reticulum	IBA
GO:0005783	Component	Endoplasmic reticulum	IDA	16647879
GO:0005794	Component	Golgi apparatus	IBA
GO:0005794	Component	Golgi apparatus	IEA
GO:0006612	Process	Protein targeting to membrane	IBA
GO:0016020	Component	Membrane	IEA
GO:0016409	Function	Palmitoyltransferase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0016746	Function	Acyltransferase activity	IEA
GO:0018230	Process	Peptidyl-L-cysteine S-palmitoylation	IDA	20074548
GO:0019706	Function	Protein-cysteine S-palmitoyltransferase activity	IBA
GO:0019706	Function	Protein-cysteine S-palmitoyltransferase activity	IDA	20074548, 37802024
GO:0019706	Function	Protein-cysteine S-palmitoyltransferase activity	IEA
GO:0035973	Process	Aggrephagy	IDA	17580304
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0071211	Process	Protein targeting to vacuole involved in autophagy	IDA	37802024
GO:0097356	Component	Perinucleolar compartment	IDA	20074548
GO:1905337	Process	Positive regulation of aggrephagy	IDA	37802024

MIM	HGNC	e!Ensembl
618671	20713	ENSG00000163958

Q8WVZ1

Protein name

Palmitoyltransferase ZDHHC19 (EC 2.3.1.225) (Zinc finger DHHC domain-containing protein 19) (DHHC-19)

Protein function

Palmitoyltransferase that mediates palmitoylation oproteins, such as RRAS and SQSTM1 (PubMed:20074548, PubMed:37802024). Catalyzes palmitoylation of RRAS, leading to increased cell viability (PubMed:20074548). Acts as a positive regulator of aut

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01529	DHHC	108 → 232	DHHC palmitoyltransferase	Family

Sequence

MTLLTDATPLVKEPHPLPLVPRPWFLPSLFAAFNVVLLVFFSGLFFAFPCRWLAQNGEWA
FPVITGSLFVLTFFSLVSLNFSDPGILHQGSAEQGPLTVHVVWVNHGAFRLQWCPKCCFH
RPPRTYHCPWCNICVEDFDHHCKWVNNCIGHRNFRFFMLLVLSLCLYSGAMLVTCLIFLV
RTTHLPFSTDKAIAIVVAVSAAGLLVPLSLLLLIQALSVSSADRTYKGKCRHLQGYNPFD
QGCASNWYLTICAPLGPKYMAEAVQLQRVVGPDWTSMPNLHPPMSPSALNPPAPTSGSLQ
SREGTPGAW

Sequence length

309

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

ZDHHC19 (zDHHC palmitoyltransferase 19)