Gene Gene information from NCBI Gene database.
Entrez ID 1315
Gene name Coat protein complex I subunit beta 1
Gene symbol COPB1
Synonyms (NCBI Gene)
BARMACSCOPB
Chromosome 11
Chromosome location 11p15.2
Summary This gene encodes a protein subunit of the coatomer complex associated with non-clathrin coated vesicles. The coatomer complex, also known as the coat protein complex 1, forms in the cytoplasm and is recruited to the Golgi by activated guanosine triphosph
miRNA miRNA information provided by mirtarbase database.
113
miRTarBase ID miRNA Experiments Reference
MIRT023931 hsa-miR-1-3p Proteomics 18668040
MIRT023931 hsa-miR-1-3p Proteomics;Microarray 18668037
MIRT050181 hsa-miR-26a-5p CLASH 23622248
MIRT045323 hsa-miR-185-5p CLASH 23622248
MIRT044867 hsa-miR-195-5p CLASH 23622248
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
35
GO ID Ontology Definition Evidence Reference
GO:0000139 Component Golgi membrane IEA
GO:0000139 Component Golgi membrane TAS 1840503
GO:0005198 Function Structural molecule activity IEA
GO:0005515 Function Protein binding IPI 10199403, 11520457, 12582157, 16189514, 17500595, 18556652, 20551905, 22555292, 24806965, 25036637, 29021621, 30352685, 30670146, 32296183, 32814053
GO:0005737 Component Cytoplasm IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
600959 2231 ENSG00000129083
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P53618
Protein name Coatomer subunit beta (Beta-coat protein) (Beta-COP)
Protein function The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi ne
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01602 Adaptin_N 18 533 Adaptin N terminal region Family
PF07718 Coatamer_beta_C 667 807 Coatomer beta C-terminal region Domain
PF14806 Coatomer_b_Cpla 813 944 Coatomer beta subunit appendage platform Domain
Sequence
MTAAENVCYTLINVPMDSEPPSEISLKNDLEKGDVKSKTEALKKVIIMILNGEKLPGLLM
TIIRFVLPLQDHTIKKLLLVFWEIVPKTTPDGRLLHEMILVCDAYRKDLQHPNEFIRGST
LRFLCKLKEAELLEPLMPAIRACLEHRHSYVRRNAVLAIYTIYRNFEHLIPDAPELIHDF
LVNEKDASCKRNAFMMLIHADQDRALDYLSTCIDQVQTFGDILQLVIVELIYKVCHANPS
ERARFIRCIYNLLQSSSPAVKYEAAGTLVTLSSAPTAIKAAAQCYIDLIIKESDNNVKLI
VLDRLIELKEHPAHERVLQDLVMDILRVLSTPDLEVRKKTLQLALDLVSSRNVEELVIVL
KKEVIKTNNVSEHEDTDKYRQLLVRTLHSCSVRFPDMAANVIPVLMEFLSDNNEAAAADV
LEFVREAIQRFDNLRMLIVEKMLEVFHAIKSVKIYRGALWILGEYCSTKEDIQSVMTEIR
RSLGEIPIVESEIKKEAGELKPEEEITVGPVQKLVTEMGTYATQSALSSSRPT
KKEEDRP
PLRGFLLDGDFFVAASLATTLTKIALRYVALVQEKKKQNSFVAEAMLLMATILHLGKSSL
PKKPITDDDVDRISLCLKVLSECSPLMNDIFNKECRQSLSHMLSAKLEEEKLSQKKESEK
RNVTVQPDDPISFMQLTAKNEMNCKEDQFQLSLLAAMGNTQRKEAADPLASKLNKVTQLT
GFSDPVYAEAYVHVNQYDIVLDVLVVNQTSDTLQNCTLELATLGDLKLVEKPSPLTLAPH
DFANIKANVKVASTENGIIFGNIVYDV
SGAASDRNCVVLSDIHIDIMDYIQPATCTDAEF
RQMWAEFEWENKVTVNTNMVDLNDYLQHILKSTNMKCLTPEKALSGYCGFMAANLYARSI
FGEDALANVSIEKPIHQGPDAAVTGHIRIRAKSQGMALSLGDKI
NLSQKKTSI
Sequence length 953
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Neutrophil degranulation
COPI-mediated anterograde transport
COPI-dependent Golgi-to-ER retrograde traffic
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
20
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
Baralle-Macken syndrome Likely pathogenic; Pathogenic rs1850695885, rs1850476947 RCV001354045
RCV001354046
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Cataract Likely pathogenic; Pathogenic rs1850695885, rs1850476947 RCV001290300
RCV001290321
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Delayed speech and language development Pathogenic rs2493876974 RCV002292384
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Failure to thrive Pathogenic rs2493876974 RCV002292384
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
Cervical cancer Conflicting classifications of pathogenicity ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney Uncertain significance ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Colorectal cancer Uncertain significance ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Gastric cancer Uncertain significance; Conflicting classifications of pathogenicity ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Familial lichen amyloidosis Lichen amyloidosis BEFREE 29129687
★☆☆☆☆
Found in Text Mining only
Hepatolenticular Degeneration Hepatolenticular degeneration Pubtator 11415452 Associate
★☆☆☆☆
Found in Text Mining only
Malignant neoplasm of prostate Prostate cancer BEFREE 29129687
★☆☆☆☆
Found in Text Mining only
Polycystic Ovary Syndrome Polycystic ovary syndrome Pubtator 25342854 Inhibit
★☆☆☆☆
Found in Text Mining only
Prostate carcinoma Prostate cancer BEFREE 29129687
★☆☆☆☆
Found in Text Mining only