Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	1314
Gene name	Coat protein complex I subunit alpha
Gene symbol	COPA
Synonyms (NCBI Gene)	AIAISDAILJKHEP-COPalpha-COP
Chromosome	1
Chromosome location	1q23.2
Summary	In eukaryotic cells, protein transport between the endoplasmic reticulum and Golgi compartments is mediated in part by non-clathrin-coated vesicular coat proteins (COPs). Seven coat proteins have been identified, and they represent subunits of a complex k

Show/Hide all (5)

SNP ID	Visualize variation	Clinical significance	Consequence
rs794727993	C>T	Pathogenic	Missense variant, coding sequence variant
rs794727994	T>C	Pathogenic	Missense variant, coding sequence variant
rs794727995	C>T	Pathogenic	Missense variant, coding sequence variant
rs864309710	C>A	Pathogenic	Missense variant, coding sequence variant
rs1557868211	C>G	Likely-pathogenic	Coding sequence variant, missense variant

327

Show/Hide all (327)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017123	hsa-miR-335-5p	Microarray	18185580
MIRT047710	hsa-miR-10a-5p	CLASH	23622248
MIRT046345	hsa-miR-23b-3p	CLASH	23622248
MIRT042473	hsa-miR-423-3p	CLASH	23622248
MIRT041376	hsa-miR-193b-3p	CLASH	23622248
MIRT040641	hsa-miR-92b-3p	CLASH	23622248
MIRT039417	hsa-miR-421	CLASH	23622248
MIRT037463	hsa-miR-744-5p	CLASH	23622248
MIRT052740	hsa-miR-1260b	CLASH	23622248
MIRT516415	hsa-miR-4695-3p	PAR-CLIP	23446348
MIRT516413	hsa-miR-4746-3p	PAR-CLIP	23446348
MIRT516412	hsa-miR-3135b	PAR-CLIP	23446348
MIRT516411	hsa-miR-504-3p	PAR-CLIP	23446348
MIRT516410	hsa-miR-122-5p	PAR-CLIP	23446348
MIRT516409	hsa-miR-4634	PAR-CLIP	23446348
MIRT516407	hsa-miR-3652	PAR-CLIP	23446348
MIRT516408	hsa-miR-4430	PAR-CLIP	23446348
MIRT488430	hsa-miR-4517	PAR-CLIP	23592263
MIRT488429	hsa-miR-648	PAR-CLIP	23592263
MIRT488428	hsa-miR-3976	PAR-CLIP	23592263
MIRT488427	hsa-miR-4712-3p	PAR-CLIP	23592263
MIRT488426	hsa-miR-539-5p	PAR-CLIP	23592263
MIRT488425	hsa-miR-589-5p	PAR-CLIP	23592263
MIRT488424	hsa-miR-146a-5p	PAR-CLIP	23592263
MIRT488423	hsa-miR-146b-5p	PAR-CLIP	23592263
MIRT488421	hsa-miR-7153-5p	PAR-CLIP	23592263
MIRT488422	hsa-miR-142-3p	PAR-CLIP	23592263
MIRT488420	hsa-miR-376a-3p	PAR-CLIP	23592263
MIRT488419	hsa-miR-376b-3p	PAR-CLIP	23592263
MIRT488418	hsa-miR-3591-5p	PAR-CLIP	23592263
MIRT440914	hsa-miR-127-5p	HITS-CLIP	24374217
MIRT440914	hsa-miR-127-5p	HITS-CLIP	24374217
MIRT516415	hsa-miR-4695-3p	PAR-CLIP	23446348
MIRT516413	hsa-miR-4746-3p	PAR-CLIP	23446348
MIRT516412	hsa-miR-3135b	PAR-CLIP	23446348
MIRT516411	hsa-miR-504-3p	PAR-CLIP	23446348
MIRT516410	hsa-miR-122-5p	PAR-CLIP	23446348
MIRT516409	hsa-miR-4634	PAR-CLIP	23446348
MIRT516407	hsa-miR-3652	PAR-CLIP	23446348
MIRT516408	hsa-miR-4430	PAR-CLIP	23446348
MIRT488430	hsa-miR-4517	PAR-CLIP	23592263
MIRT488429	hsa-miR-648	PAR-CLIP	23592263
MIRT488428	hsa-miR-3976	PAR-CLIP	23592263
MIRT488427	hsa-miR-4712-3p	PAR-CLIP	23592263
MIRT488426	hsa-miR-539-5p	PAR-CLIP	23592263
MIRT488425	hsa-miR-589-5p	PAR-CLIP	23592263
MIRT488424	hsa-miR-146a-5p	PAR-CLIP	23592263
MIRT488423	hsa-miR-146b-5p	PAR-CLIP	23592263
MIRT488421	hsa-miR-7153-5p	PAR-CLIP	23592263
MIRT488422	hsa-miR-142-3p	PAR-CLIP	23592263
MIRT488420	hsa-miR-376a-3p	PAR-CLIP	23592263
MIRT488419	hsa-miR-376b-3p	PAR-CLIP	23592263
MIRT488418	hsa-miR-3591-5p	PAR-CLIP	23592263
MIRT903742	hsa-miR-1207-5p	CLIP-seq
MIRT903743	hsa-miR-3665	CLIP-seq
MIRT903744	hsa-miR-3907	CLIP-seq
MIRT903745	hsa-miR-4645-3p	CLIP-seq
MIRT903746	hsa-miR-4704-3p	CLIP-seq
MIRT903747	hsa-miR-4717-3p	CLIP-seq
MIRT903748	hsa-miR-4736	CLIP-seq
MIRT903749	hsa-miR-4763-3p	CLIP-seq
MIRT903750	hsa-miR-764	CLIP-seq
MIRT903751	hsa-miR-1185	CLIP-seq
MIRT903742	hsa-miR-1207-5p	CLIP-seq
MIRT903752	hsa-miR-122	CLIP-seq
MIRT903753	hsa-miR-1273f	CLIP-seq
MIRT903754	hsa-miR-1289	CLIP-seq
MIRT903755	hsa-miR-1290	CLIP-seq
MIRT903756	hsa-miR-129-5p	CLIP-seq
MIRT903757	hsa-miR-134	CLIP-seq
MIRT903758	hsa-miR-143	CLIP-seq
MIRT903759	hsa-miR-3118	CLIP-seq
MIRT903760	hsa-miR-3136-5p	CLIP-seq
MIRT903761	hsa-miR-3154	CLIP-seq
MIRT903762	hsa-miR-3173-3p	CLIP-seq
MIRT903763	hsa-miR-3187-3p	CLIP-seq
MIRT903764	hsa-miR-3198	CLIP-seq
MIRT903765	hsa-miR-326	CLIP-seq
MIRT903766	hsa-miR-330-5p	CLIP-seq
MIRT903767	hsa-miR-3664-5p	CLIP-seq
MIRT903743	hsa-miR-3665	CLIP-seq
MIRT903768	hsa-miR-3679-5p	CLIP-seq
MIRT903744	hsa-miR-3907	CLIP-seq
MIRT903769	hsa-miR-425	CLIP-seq
MIRT903770	hsa-miR-4269	CLIP-seq
MIRT903771	hsa-miR-4294	CLIP-seq
MIRT903772	hsa-miR-4309	CLIP-seq
MIRT903773	hsa-miR-4435	CLIP-seq
MIRT903774	hsa-miR-4438	CLIP-seq
MIRT903775	hsa-miR-4439	CLIP-seq
MIRT903776	hsa-miR-4513	CLIP-seq
MIRT903777	hsa-miR-4514	CLIP-seq
MIRT903778	hsa-miR-4534	CLIP-seq
MIRT903779	hsa-miR-4639-3p	CLIP-seq
MIRT903745	hsa-miR-4645-3p	CLIP-seq
MIRT903780	hsa-miR-4645-5p	CLIP-seq
MIRT903781	hsa-miR-4659a-5p	CLIP-seq
MIRT903782	hsa-miR-4659b-5p	CLIP-seq
MIRT903783	hsa-miR-4667-5p	CLIP-seq
MIRT903784	hsa-miR-4673	CLIP-seq
MIRT903785	hsa-miR-4692	CLIP-seq
MIRT903786	hsa-miR-4700-5p	CLIP-seq
MIRT903787	hsa-miR-4701-5p	CLIP-seq
MIRT903746	hsa-miR-4704-3p	CLIP-seq
MIRT903788	hsa-miR-4708-5p	CLIP-seq
MIRT903789	hsa-miR-4716-5p	CLIP-seq
MIRT903747	hsa-miR-4717-3p	CLIP-seq
MIRT903790	hsa-miR-4729	CLIP-seq
MIRT903748	hsa-miR-4736	CLIP-seq
MIRT903791	hsa-miR-4755-3p	CLIP-seq
MIRT903749	hsa-miR-4763-3p	CLIP-seq
MIRT903792	hsa-miR-4770	CLIP-seq
MIRT903793	hsa-miR-4776-3p	CLIP-seq
MIRT903794	hsa-miR-4781-3p	CLIP-seq
MIRT903795	hsa-miR-4795-3p	CLIP-seq
MIRT903796	hsa-miR-4797-5p	CLIP-seq
MIRT903797	hsa-miR-498	CLIP-seq
MIRT903798	hsa-miR-5095	CLIP-seq
MIRT903799	hsa-miR-520a-5p	CLIP-seq
MIRT903800	hsa-miR-525-5p	CLIP-seq
MIRT903801	hsa-miR-548p	CLIP-seq
MIRT903802	hsa-miR-548s	CLIP-seq
MIRT903803	hsa-miR-570	CLIP-seq
MIRT903804	hsa-miR-586	CLIP-seq
MIRT903805	hsa-miR-587	CLIP-seq
MIRT903806	hsa-miR-588	CLIP-seq
MIRT903807	hsa-miR-625	CLIP-seq
MIRT903808	hsa-miR-637	CLIP-seq
MIRT903809	hsa-miR-642b	CLIP-seq
MIRT903810	hsa-miR-668	CLIP-seq
MIRT903750	hsa-miR-764	CLIP-seq
MIRT903811	hsa-miR-940	CLIP-seq
MIRT903812	hsa-miR-944	CLIP-seq
MIRT1967940	hsa-miR-1	CLIP-seq
MIRT903742	hsa-miR-1207-5p	CLIP-seq
MIRT903752	hsa-miR-122	CLIP-seq
MIRT903756	hsa-miR-129-5p	CLIP-seq
MIRT903758	hsa-miR-143	CLIP-seq
MIRT1967941	hsa-miR-206	CLIP-seq
MIRT1967942	hsa-miR-3148	CLIP-seq
MIRT1967943	hsa-miR-3194-3p	CLIP-seq
MIRT903765	hsa-miR-326	CLIP-seq
MIRT903766	hsa-miR-330-5p	CLIP-seq
MIRT1967944	hsa-miR-3616-5p	CLIP-seq
MIRT1967945	hsa-miR-3647-5p	CLIP-seq
MIRT903743	hsa-miR-3665	CLIP-seq
MIRT1967946	hsa-miR-3672	CLIP-seq
MIRT1967947	hsa-miR-3673	CLIP-seq
MIRT903744	hsa-miR-3907	CLIP-seq
MIRT1967948	hsa-miR-3978	CLIP-seq
MIRT1967949	hsa-miR-4264	CLIP-seq
MIRT1967950	hsa-miR-4302	CLIP-seq
MIRT1967951	hsa-miR-431	CLIP-seq
MIRT903779	hsa-miR-4639-3p	CLIP-seq
MIRT903783	hsa-miR-4667-5p	CLIP-seq
MIRT903786	hsa-miR-4700-5p	CLIP-seq
MIRT903747	hsa-miR-4717-3p	CLIP-seq
MIRT1967952	hsa-miR-4735-5p	CLIP-seq
MIRT903748	hsa-miR-4736	CLIP-seq
MIRT903791	hsa-miR-4755-3p	CLIP-seq
MIRT903749	hsa-miR-4763-3p	CLIP-seq
MIRT903792	hsa-miR-4770	CLIP-seq
MIRT1967953	hsa-miR-4775	CLIP-seq
MIRT1967954	hsa-miR-4795-5p	CLIP-seq
MIRT1967955	hsa-miR-4797-3p	CLIP-seq
MIRT903796	hsa-miR-4797-5p	CLIP-seq
MIRT903797	hsa-miR-498	CLIP-seq
MIRT903798	hsa-miR-5095	CLIP-seq
MIRT1967956	hsa-miR-548aa	CLIP-seq
MIRT1967957	hsa-miR-556-3p	CLIP-seq
MIRT1967958	hsa-miR-573	CLIP-seq
MIRT1967959	hsa-miR-590-3p	CLIP-seq
MIRT1967960	hsa-miR-613	CLIP-seq
MIRT903807	hsa-miR-625	CLIP-seq
MIRT903808	hsa-miR-637	CLIP-seq
MIRT903809	hsa-miR-642b	CLIP-seq
MIRT903750	hsa-miR-764	CLIP-seq
MIRT1967961	hsa-miR-924	CLIP-seq
MIRT1967940	hsa-miR-1	CLIP-seq
MIRT2203858	hsa-miR-1200	CLIP-seq
MIRT2203859	hsa-miR-1207-3p	CLIP-seq
MIRT903742	hsa-miR-1207-5p	CLIP-seq
MIRT903752	hsa-miR-122	CLIP-seq
MIRT2203860	hsa-miR-1281	CLIP-seq
MIRT1967941	hsa-miR-206	CLIP-seq
MIRT2203861	hsa-miR-217	CLIP-seq
MIRT2203862	hsa-miR-3199	CLIP-seq
MIRT1967944	hsa-miR-3616-5p	CLIP-seq
MIRT1967945	hsa-miR-3647-5p	CLIP-seq
MIRT903767	hsa-miR-3664-5p	CLIP-seq
MIRT903743	hsa-miR-3665	CLIP-seq
MIRT1967947	hsa-miR-3673	CLIP-seq
MIRT903744	hsa-miR-3907	CLIP-seq
MIRT903770	hsa-miR-4269	CLIP-seq
MIRT2203863	hsa-miR-4324	CLIP-seq
MIRT2203864	hsa-miR-4418	CLIP-seq
MIRT903774	hsa-miR-4438	CLIP-seq
MIRT2203865	hsa-miR-4468	CLIP-seq
MIRT903779	hsa-miR-4639-3p	CLIP-seq
MIRT903747	hsa-miR-4717-3p	CLIP-seq
MIRT903748	hsa-miR-4736	CLIP-seq
MIRT903749	hsa-miR-4763-3p	CLIP-seq
MIRT2203866	hsa-miR-4772-3p	CLIP-seq
MIRT1967954	hsa-miR-4795-5p	CLIP-seq
MIRT903797	hsa-miR-498	CLIP-seq
MIRT2203867	hsa-miR-509-3-5p	CLIP-seq
MIRT903798	hsa-miR-5095	CLIP-seq
MIRT2203868	hsa-miR-509-5p	CLIP-seq
MIRT903799	hsa-miR-520a-5p	CLIP-seq
MIRT903800	hsa-miR-525-5p	CLIP-seq
MIRT2203869	hsa-miR-544b	CLIP-seq
MIRT1967958	hsa-miR-573	CLIP-seq
MIRT1967960	hsa-miR-613	CLIP-seq
MIRT2203870	hsa-miR-646	CLIP-seq
MIRT903750	hsa-miR-764	CLIP-seq
MIRT903752	hsa-miR-122	CLIP-seq
MIRT1967949	hsa-miR-4264	CLIP-seq
MIRT1967955	hsa-miR-4797-3p	CLIP-seq
MIRT903752	hsa-miR-122	CLIP-seq
MIRT903797	hsa-miR-498	CLIP-seq
MIRT1967940	hsa-miR-1	CLIP-seq
MIRT2507053	hsa-miR-1183	CLIP-seq
MIRT2203858	hsa-miR-1200	CLIP-seq
MIRT2203859	hsa-miR-1207-3p	CLIP-seq
MIRT903752	hsa-miR-122	CLIP-seq
MIRT2507054	hsa-miR-1228	CLIP-seq
MIRT2507055	hsa-miR-1253	CLIP-seq
MIRT903755	hsa-miR-1290	CLIP-seq
MIRT2507056	hsa-miR-200b	CLIP-seq
MIRT2507057	hsa-miR-200c	CLIP-seq
MIRT1967941	hsa-miR-206	CLIP-seq
MIRT2507058	hsa-miR-2110	CLIP-seq
MIRT2507059	hsa-miR-3151	CLIP-seq
MIRT2507060	hsa-miR-3153	CLIP-seq
MIRT903762	hsa-miR-3173-3p	CLIP-seq
MIRT2507061	hsa-miR-3179	CLIP-seq
MIRT2203862	hsa-miR-3199	CLIP-seq
MIRT2507062	hsa-miR-320a	CLIP-seq
MIRT2507063	hsa-miR-320b	CLIP-seq
MIRT2507064	hsa-miR-320c	CLIP-seq
MIRT2507065	hsa-miR-320d	CLIP-seq
MIRT2507066	hsa-miR-3613-3p	CLIP-seq
MIRT1967944	hsa-miR-3616-5p	CLIP-seq
MIRT1967945	hsa-miR-3647-5p	CLIP-seq
MIRT1967947	hsa-miR-3673	CLIP-seq
MIRT2507067	hsa-miR-3684	CLIP-seq
MIRT2507068	hsa-miR-370	CLIP-seq
MIRT2507069	hsa-miR-371b-5p	CLIP-seq
MIRT1967949	hsa-miR-4264	CLIP-seq
MIRT2507070	hsa-miR-4268	CLIP-seq
MIRT903770	hsa-miR-4269	CLIP-seq
MIRT2507071	hsa-miR-4271	CLIP-seq
MIRT2507072	hsa-miR-429	CLIP-seq
MIRT2203863	hsa-miR-4324	CLIP-seq
MIRT2507073	hsa-miR-4429	CLIP-seq
MIRT903774	hsa-miR-4438	CLIP-seq
MIRT2507074	hsa-miR-4447	CLIP-seq
MIRT2507075	hsa-miR-4448	CLIP-seq
MIRT2203865	hsa-miR-4468	CLIP-seq
MIRT2507076	hsa-miR-4472	CLIP-seq
MIRT2507077	hsa-miR-4698	CLIP-seq
MIRT2507078	hsa-miR-4724-5p	CLIP-seq
MIRT2507079	hsa-miR-4725-3p	CLIP-seq
MIRT1967952	hsa-miR-4735-5p	CLIP-seq
MIRT903791	hsa-miR-4755-3p	CLIP-seq
MIRT1967953	hsa-miR-4775	CLIP-seq
MIRT2507080	hsa-miR-4779	CLIP-seq
MIRT2507081	hsa-miR-4793-5p	CLIP-seq
MIRT1967954	hsa-miR-4795-5p	CLIP-seq
MIRT1967955	hsa-miR-4797-3p	CLIP-seq
MIRT2507082	hsa-miR-491-5p	CLIP-seq
MIRT903797	hsa-miR-498	CLIP-seq
MIRT903798	hsa-miR-5095	CLIP-seq
MIRT903799	hsa-miR-520a-5p	CLIP-seq
MIRT903800	hsa-miR-525-5p	CLIP-seq
MIRT2203869	hsa-miR-544b	CLIP-seq
MIRT1967957	hsa-miR-556-3p	CLIP-seq
MIRT1967958	hsa-miR-573	CLIP-seq
MIRT2507083	hsa-miR-580	CLIP-seq
MIRT903805	hsa-miR-587	CLIP-seq
MIRT1967959	hsa-miR-590-3p	CLIP-seq
MIRT1967960	hsa-miR-613	CLIP-seq
MIRT2203870	hsa-miR-646	CLIP-seq
MIRT1967940	hsa-miR-1	CLIP-seq
MIRT2203858	hsa-miR-1200	CLIP-seq
MIRT2203859	hsa-miR-1207-3p	CLIP-seq
MIRT903752	hsa-miR-122	CLIP-seq
MIRT2678451	hsa-miR-1303	CLIP-seq
MIRT2507056	hsa-miR-200b	CLIP-seq
MIRT2507057	hsa-miR-200c	CLIP-seq
MIRT1967941	hsa-miR-206	CLIP-seq
MIRT2507058	hsa-miR-2110	CLIP-seq
MIRT2507059	hsa-miR-3151	CLIP-seq
MIRT2507060	hsa-miR-3153	CLIP-seq
MIRT903762	hsa-miR-3173-3p	CLIP-seq
MIRT2507061	hsa-miR-3179	CLIP-seq
MIRT2203862	hsa-miR-3199	CLIP-seq
MIRT2507062	hsa-miR-320a	CLIP-seq
MIRT2507063	hsa-miR-320b	CLIP-seq
MIRT2507064	hsa-miR-320c	CLIP-seq
MIRT2507065	hsa-miR-320d	CLIP-seq
MIRT1967944	hsa-miR-3616-5p	CLIP-seq
MIRT1967945	hsa-miR-3647-5p	CLIP-seq
MIRT1967947	hsa-miR-3673	CLIP-seq
MIRT1967949	hsa-miR-4264	CLIP-seq
MIRT2507071	hsa-miR-4271	CLIP-seq
MIRT2507072	hsa-miR-429	CLIP-seq
MIRT2203863	hsa-miR-4324	CLIP-seq
MIRT2507073	hsa-miR-4429	CLIP-seq
MIRT2507074	hsa-miR-4447	CLIP-seq
MIRT2203865	hsa-miR-4468	CLIP-seq
MIRT2507076	hsa-miR-4472	CLIP-seq
MIRT2507078	hsa-miR-4724-5p	CLIP-seq
MIRT2507079	hsa-miR-4725-3p	CLIP-seq
MIRT1967952	hsa-miR-4735-5p	CLIP-seq
MIRT903791	hsa-miR-4755-3p	CLIP-seq
MIRT1967953	hsa-miR-4775	CLIP-seq
MIRT2507080	hsa-miR-4779	CLIP-seq
MIRT1967954	hsa-miR-4795-5p	CLIP-seq
MIRT1967955	hsa-miR-4797-3p	CLIP-seq
MIRT2507082	hsa-miR-491-5p	CLIP-seq
MIRT903797	hsa-miR-498	CLIP-seq
MIRT2203869	hsa-miR-544b	CLIP-seq
MIRT1967958	hsa-miR-573	CLIP-seq
MIRT1967959	hsa-miR-590-3p	CLIP-seq
MIRT1967960	hsa-miR-613	CLIP-seq
MIRT2203870	hsa-miR-646	CLIP-seq

Show/Hide all (39)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IEA
GO:0000139	Component	Golgi membrane	TAS
GO:0003729	Function	MRNA binding	IEA
GO:0005179	Function	Hormone activity	IEA
GO:0005198	Function	Structural molecule activity	IEA
GO:0005515	Function	Protein binding	IPI	16169070, 25051373, 30352685, 33961781, 35271311
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IDA	1429581
GO:0005737	Component	Cytoplasm	IDA	9115636
GO:0005737	Component	Cytoplasm	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0005794	Component	Golgi apparatus	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006886	Process	Intracellular protein transport	IBA
GO:0006886	Process	Intracellular protein transport	IEA
GO:0006888	Process	Endoplasmic reticulum to Golgi vesicle-mediated transport	IBA
GO:0006888	Process	Endoplasmic reticulum to Golgi vesicle-mediated transport	IEA
GO:0006890	Process	Retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum	IBA
GO:0006891	Process	Intra-Golgi vesicle-mediated transport	IBA
GO:0007165	Process	Signal transduction	IEA
GO:0015031	Process	Protein transport	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IEA
GO:0016192	Process	Vesicle-mediated transport	IEA
GO:0030117	Component	Membrane coat	IEA
GO:0030126	Component	COPI vesicle coat	IBA
GO:0030126	Component	COPI vesicle coat	IDA	14729954
GO:0030126	Component	COPI vesicle coat	IEA
GO:0030126	Component	COPI vesicle coat	ISS
GO:0030133	Component	Transport vesicle	TAS
GO:0030137	Component	COPI-coated vesicle	IEA
GO:0030157	Process	Pancreatic juice secretion	IDA	1429581
GO:0030426	Component	Growth cone	IDA	21300694
GO:0030426	Component	Growth cone	IEA
GO:0030663	Component	COPI-coated vesicle membrane	IEA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0070062	Component	Extracellular exosome	HDA	19199708
GO:0099612	Process	Protein localization to axon	IEA
GO:1902463	Process	Protein localization to cell leading edge	IEA

MIM	HGNC	e!Ensembl
601924	2230	ENSG00000122218

P53621

Protein name

Coatomer subunit alpha (Alpha-coat protein) (Alpha-COP) (HEP-COP) (HEPCOP) [Cleaved into: Xenin (Xenopsin-related peptide); Proxenin]

Protein function

The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi ne

PDB

6PBG , 6TZT , 6U3V

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00400	WD40	41 → 79	WD domain, G-beta repeat	Repeat
PF00400	WD40	83 → 121	WD domain, G-beta repeat	Repeat
PF00400	WD40	125 → 163	WD domain, G-beta repeat	Repeat
PF12894	ANAPC4_WD40	211 → 302	Anaphase-promoting complex subunit 4 WD40 domain	Repeat
PF04053	Coatomer_WDAD	338 → 767	Coatomer WD associated region	Family
PF06957	COPI_C	815 → 1224	Coatomer (COPI) alpha subunit C-terminus	Family

Tissue specificity

TISSUE SPECIFICITY: Uniformly expressed in a wide range of adult and fetal tissues. Xenin is found in gastric, duodenal and jejunal mucosa. Circulates in the blood. Seems to be confined to specific endocrine cells.

Sequence

MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH
KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRVW
NWQSRTCVCVLTGHNHYVMCAQFHPTEDLVVSASLDQTVRVWDISGLRKKNLSPGAVESD
VRGITGVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESKAW
EVDTCRGHYNNVSCAVFHPRQELILSNSEDKSIRVWDMSKRTGVQTFRRDHDRFWVLAAH
PNLNLFAAGHDGGMIVFKLERERPAYAVHGNMLHYVKDRFLRQLDFNSSKDVAVMQLRSG
SKFPVFNMSYNPAENAVLLCTRASNLENSTYDLYTIPKDADSQNPDAPEGKRSSGLTAVW
VARNRFAVLDRMHSLLIKNLKNEITKKVQVPNCDEIFYAGTGNLLLRDADSITLFDVQQK
RTLASVKISKVKYVIWSADMSHVALLAKHAIVICNRKLDALCNIHENIRVKSGAWDESGV
FIYTTSNHIKYAVTTGDHGIIRTLDLPIYVTRVKGNNVYCLDRECRPRVLTIDPTEFKFK
LALINRKYDEVLHMVRNAKLVGQSIIAYLQKKGYPEVALHFVKDEKTRFSLALECGNIEI
ALEAAKALDDKNCWEKLGEVALLQGNHQIVEMCYQRTKNFDKLSFLYLITGNLEKLRKMM
KIAEIRKDMSGHYQNALYLGDVSERVRILKNCGQKSLAYLTAATHGLDEEAESLKETFDP
EKETIPDIDPNAKLLQPPAPIMPLDTNWPLLTVSKGFFEGTIASKGKGGALAADIDIDTV
GTEGWGEDAELQLDEDGFVEATEGLGDDALGKGQEEGGGWDVEEDLELPPELDISPGAAG
GAEDGFFVPPTKGTSPTQIWCNNSQLPVDHILAGSFETAMRLLHDQVGVIQFGPYKQLFL
QTYARGRTTYQALPCLPSMYGYPNRNWKDAGLKNGVPAVGLKLNDLIQRLQLCYQLTTVG
KFEEAVEKFRSILLSVPLLVVDNKQEIAEAQQLITICREYIVGLSVETERKKLPKETLEQ
QKRICEMAAYFTHSNLQPVHMILVLRTALNLFFKLKNFKTAATFARRLLELGPKPEVAQQ
TRKILSACEKNPTDAYQLNYDMHNPFDICAASYRPIYRGKPVEKCPLSGACYSPEFKGQI
CRVTTVTEIGKDVIGLRISPLQFR

Sequence length

1224

Interactions

View interactions

	Reactome
			COPI-mediated anterograde transport COPI-dependent Golgi-to-ER retrograde traffic

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Autoimmune interstitial lung disease-arthritis syndrome	Likely pathogenic; Pathogenic	rs2101847465, rs794727993, rs794727995, rs864309710, rs2525368687, rs1557868211	RCV002052128 RCV000180776 RCV000180778 RCV000203296 RCV003990540 RCV000700608 View all (1 more)	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (18)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Acute myeloid leukemia	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANKYLOSING SPONDYLITIS AND OTHER INFLAMMATORY SPONDYLOPATHIES	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTHRITIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE DISEASES	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE INTERSTITIAL LUNG DISEASE, ARTHRITIS SYNDROME	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOINFLAMMATION AND AUTOIMMUNITY, SYSTEMIC, WITH IMMUNE DYSREGULATION 1	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autosomal dominant Alport syndrome	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COPA-related disorder	Benign; Conflicting classifications of pathogenicity; Uncertain significance; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Uncertain significance; Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG DISEASES, INTERSTITIAL	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Systemic autoinflammation	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Systemic lupus erythematosus, susceptibility to, 1	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uveal melanoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (48)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Arthritis	Arthritis	BEFREE	25894502, 27224741, 31666386		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Arthritis	Arthritis	CTD_human_DG	25894502		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Arthritis	Arthritis	Pubtator	25894502	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Arthritis	Arthritis	HPO_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Diseases	Autoimmune Diseases	CTD_human_DG	25894502		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Diseases	Autoimmune disease	Pubtator	25894502	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune interstitial lung disease-arthritis syndrome	Autoimmune Interstitial Lung Disease-Arthritis Syndrome	Orphanet			★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
AUTOIMMUNE INTERSTITIAL LUNG, JOINT, AND KIDNEY DISEASE	Autoimmune Interstitial Lung, Joint, And Kidney Disease	ORPHANET_DG	25894502		★★★★★ ★☆☆☆☆ Found in Text Mining only
AUTOIMMUNE INTERSTITIAL LUNG, JOINT, AND KIDNEY DISEASE	Autoimmune Interstitial Lung, Joint, And Kidney Disease	UNIPROT_DG	25894502		★★★★★ ★☆☆☆☆ Found in Text Mining only
AUTOIMMUNE INTERSTITIAL LUNG, JOINT, AND KIDNEY DISEASE	Autoimmune Interstitial Lung, Joint, And Kidney Disease	CLINVAR_DG	25894502		★★★★★ ★☆☆☆☆ Found in Text Mining only
AUTOIMMUNE INTERSTITIAL LUNG, JOINT, AND KIDNEY DISEASE	Autoimmune Interstitial Lung, Joint, And Kidney Disease	BEFREE	29137621		★★★★★ ★☆☆☆☆ Found in Text Mining only
AUTOIMMUNE INTERSTITIAL LUNG, JOINT, AND KIDNEY DISEASE	Autoimmune Interstitial Lung, Joint, And Kidney Disease	GENOMICS_ENGLAND_DG	29137621		★★★★★ ★☆☆☆☆ Found in Text Mining only
AUTOIMMUNE INTERSTITIAL LUNG, JOINT, AND KIDNEY DISEASE	Autoimmune Interstitial Lung, Joint, And Kidney Disease	CTD_human_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoinflammatory disorder	Autoinflammatory Disease	GENOMICS_ENGLAND_DG	29137621		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchiolitis Obliterans	Bronchiolitis obliterans	Pubtator	35578185	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	35769782	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	28161934	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cough	Cough	Pubtator	30385646	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cryoglobulinemia	Cryoglobulinemia	Pubtator	39620212	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	29412820, 29633491, 31738969		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	29412820, 29633491, 31738969		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	20421298, 28004148, 29412820		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	29196126		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glycosuria Renal	Renal glycosuria	Pubtator	37877458	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemangiosarcoma	Hemangiosarcoma	BEFREE	28588707		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	20421298		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypersensitivity Immediate	Hypersensitivity	Pubtator	32725128	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	36796022	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	12586295		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	23766440		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	25894502		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	25894502, 30385646, 36333696	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases, Interstitial	Lung Diseases	CTD_human_DG	25894502		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Diseases, Interstitial	Lung Diseases	BEFREE	29030294, 31666386		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Diseases, Interstitial	Lung Diseases	HPO_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	27197184		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	20153416		★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Atrophy Spinal	Spinal muscular atrophy	Pubtator	23727837	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	12586295, 20153416		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	28190525, 29633491		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyarthritis	Polyarthritis	CTD_human_DG	25894502		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyarthritis	Polyarthritis	BEFREE	29030294		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	31010340		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	31666386		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	35132330	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Spinal Muscular Atrophy	Spinal Muscular Atrophy	BEFREE	23727837, 26464491, 31060774		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	27197184		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	34991628	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

COPA (coat protein complex I subunit alpha)