LYZL4 (lysozyme like 4)

Gene

• Entrez ID: 131375
• Gene name: Lysozyme like 4
• Gene symbol: LYZL4
• Synonyms (NCBI Gene): LYC4, LYZA
• Chromosome: 3
• Chromosome location: 3p22.1
• Summary: Lysozymes (see LYZ; MIM 153450), especially C-type lysozymes, are well-recognized bacteriolytic factors widely distributed in the animal kingdom and play a mainly protective role in host defense. LYZL4 is a member of a family of lysozyme-like genes (Zhang

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT2035141	hsa-miR-511	CLIP-seq
MIRT2035142	hsa-miR-587	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001669	Component	Acrosomal vesicle	IBA
GO:0001669	Component	Acrosomal vesicle	IEA
GO:0001669	Component	Acrosomal vesicle	ISS
GO:0003796	Function	Lysozyme activity	IEA
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IEA
GO:0005615	Component	Extracellular space	ISS
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005929	Component	Cilium	IEA
GO:0007338	Process	Single fertilization	IEA
GO:0007342	Process	Fusion of sperm to egg plasma membrane involved in single fertilization	IBA
GO:0009566	Process	Fertilization	IEA
GO:0009566	Process	Fertilization	ISS
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0031514	Component	Motile cilium	IEA
GO:0036126	Component	Sperm flagellum	IBA
GO:0036126	Component	Sperm flagellum	IEA
GO:0036126	Component	Sperm flagellum	ISS
GO:0042742	Process	Defense response to bacterium	ISS
GO:0042995	Component	Cell projection	IEA

Other IDs

• MIM: 612750
• HGNC: 28387
• e!Ensembl: ENSG00000157093

Protein

• UniProt ID: Q96KX0
• Protein name: Lysozyme-like protein 4 (Lysozyme-4)
• Protein function: May be involved in fertilization (By similarity). Has no detectable bacteriolytic and lysozyme activities in vitro (By similarity).
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00062	Lys	20 → 144	C-type lysozyme/alpha-lactalbumin family	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in testis and epididymis. {ECO:0000269|PubMed:16014814}.
• Sequence:

  MKASVVLSLLGYLVVPSGAYILGRCTVAKKLHDGGLDYFEGYSLENWVCLAYFESKFNPM
  AIYENTREGYTGFGLFQMRGSDWCGDHGRNRCHMSCSALLNPNLEKTIKCAKTIVKGKEG
  MGAWPTWSRYCQYSDTLARWLDGCKL

• Sequence length: 146

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
BIPOLAR DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations