FAM3D (FAM3 metabolism regulating signaling molecule D)

Gene

• Entrez ID: 131177
• Gene name: FAM3 metabolism regulating signaling molecule D
• Gene symbol: FAM3D
• Synonyms (NCBI Gene): EF7, OIT1
• Chromosome: 3
• Chromosome location: 3p14.2

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT713847	hsa-miR-6835-3p	HITS-CLIP	19536157
MIRT713846	hsa-miR-6871-3p	HITS-CLIP	19536157
MIRT713845	hsa-miR-1324	HITS-CLIP	19536157
MIRT713844	hsa-miR-140-3p	HITS-CLIP	19536157
MIRT713843	hsa-miR-6845-3p	HITS-CLIP	19536157
MIRT713842	hsa-miR-6873-3p	HITS-CLIP	19536157
MIRT713841	hsa-miR-4768-5p	HITS-CLIP	19536157
MIRT713840	hsa-miR-6833-3p	HITS-CLIP	19536157
MIRT713847	hsa-miR-6835-3p	HITS-CLIP	19536157
MIRT713846	hsa-miR-6871-3p	HITS-CLIP	19536157
MIRT713845	hsa-miR-1324	HITS-CLIP	19536157
MIRT713844	hsa-miR-140-3p	HITS-CLIP	19536157
MIRT713843	hsa-miR-6845-3p	HITS-CLIP	19536157
MIRT713842	hsa-miR-6873-3p	HITS-CLIP	19536157
MIRT713841	hsa-miR-4768-5p	HITS-CLIP	19536157
MIRT713840	hsa-miR-6833-3p	HITS-CLIP	19536157

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001780	Process	Neutrophil homeostasis	IEA
GO:0002618	Process	Positive regulation of macrophage antigen processing and presentation	IEA
GO:0005125	Function	Cytokine activity	NAS	12160727
GO:0005515	Function	Protein binding	IPI	28514442, 33961781
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	NAS	12160727
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0030246	Function	Carbohydrate binding	IEA
GO:0035904	Process	Aorta development	IEA
GO:0046676	Process	Negative regulation of insulin secretion	IDA	12160727
GO:1990266	Process	Neutrophil migration	IEA

Other IDs

• MIM: 608619
• HGNC: 18665
• e!Ensembl: ENSG00000198643

Protein

• UniProt ID: Q96BQ1
• Protein name: Protein FAM3D
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF15711	ILEI	99 → 187	Interleukin-like EMT inducer	Domain

• Tissue specificity: TISSUE SPECIFICITY: Abundantly expressed in placenta and weakly expressed in small intestine. {ECO:0000269|PubMed:12160727}.
• Sequence:

  MRVSGVLRLLALIFAIVTTWMFIRSYMSFSMKTIRLPRWLAASPTKEIQVKKYKCGLIKP
  CPANYFAFKICSGAANVVGPTMCFEDRMIMSPVKNNVGRGLNIALVNGTTGAVLGQKAFD
  MYSGDVMHLVKFLKEIPGGALVLVASYDDPGTKMNDESRKLFSDLGSSYAKQLGFRDSWV
  FIGAKDLRGKSPFEQFLKNSPDTNKYEGWPELLEMEGCMPPKPF

• Sequence length: 224

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
SCHIZOPHRENIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	29853563		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	26966188		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	31147452	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	36524461	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	28247283		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	35351056	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	GWASCAT_DG	27903959		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	36510584	Inhibit	★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	28247283		★☆☆☆☆ Found in Text Mining only
Narcolepsy	Narcolepsy	BEFREE	20677014		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	32047813	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	33564686	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	37338014	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	CTD_human_DG	21822266		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	36510584	Associate	★☆☆☆☆ Found in Text Mining only