Gene Gene information from NCBI Gene database.
Entrez ID 131118
Gene name DnaJ heat shock protein family (Hsp40) member C19
Gene symbol DNAJC19
Synonyms (NCBI Gene)
PAM18TIM14TIMM14
Chromosome 3
Chromosome location 3q26.33
Summary The protein encoded by this gene is thought to be part of a complex involved in the ATP-dependent transport of transit peptide-containing proteins from the inner cell membrane to the mitochondrial matrix. Defects in this gene are a cause of 3-methylglutac
SNPs SNP information provided by dbSNP.
4
SNP ID Visualize variation Clinical significance Consequence
rs137854888 C>G Pathogenic Intron variant, splice acceptor variant
rs141007488 G>A Conflicting-interpretations-of-pathogenicity Missense variant, intron variant, non coding transcript variant, coding sequence variant
rs587777224 T>- Pathogenic Coding sequence variant, non coding transcript variant, frameshift variant
rs878852999 C>T Likely-pathogenic Splice acceptor variant, intron variant
miRNA miRNA information provided by mirtarbase database.
276
miRTarBase ID miRNA Experiments Reference
MIRT001552 hsa-miR-155-5p pSILAC 18668040
MIRT001552 hsa-miR-155-5p qRT-PCR 20584899
MIRT024336 hsa-miR-215-5p Microarray 19074876
MIRT026867 hsa-miR-192-5p Microarray 19074876
MIRT045573 hsa-miR-149-5p CLASH 23622248
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
23
GO ID Ontology Definition Evidence Reference
GO:0001405 Component PAM complex, Tim23 associated import motor IBA
GO:0001671 Function ATPase activator activity IBA
GO:0005515 Function Protein binding IPI 19564938, 20053669
GO:0005739 Component Mitochondrion HTP 34800366
GO:0005739 Component Mitochondrion IDA 12592411
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
608977 30528 ENSG00000205981
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q96DA6
Protein name Mitochondrial import inner membrane translocase subunit TIM14 (DnaJ homolog subfamily C member 19)
Protein function Mitochondrial co-chaperone which forms a complex with prohibitins to regulate cardiolipin remodeling (By similarity). May be a component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00226 DnaJ 65 116 DnaJ domain Domain
Tissue specificity TISSUE SPECIFICITY: Ubiquitously expressed.
Sequence
MASTVVAVGLTIAAAGFAGRYVLQAMKHMEPQVKQVFQSLPKSAFSGGYYRGGFEPKMTK
REAALILGVSPTANKGKIRDAHRRIMLLNHPDKGGSPYIAAKINEAKDLLEGQAKK
Sequence length 116
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
9
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
3-Methylglutaconic aciduria type 3 Pathogenic rs145786060 RCV001824933
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
3-methylglutaconic aciduria type 5 Pathogenic; Likely pathogenic rs587777224, rs1560040369, rs753055824, rs2108509666, rs2108509746, rs137854888, rs764568129, rs878852999, rs2473927704, rs772236610, rs2473924536, rs2473933595, rs145786060, rs1715007577, rs755024172 RCV000106304
RCV001729987
RCV003499190
RCV001780991
RCV002051190
View all (10 more)
★★★★★
ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
DNAJC19-related disorder Pathogenic rs137854888 RCV003415625
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Gastric cancer Likely pathogenic rs772236610 RCV005871345
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
3-Methylglutaconic aciduria Uncertain significance ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
DILATED CARDIOMYOPATHY WITH ATAXIA Orphanet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus - ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Sarcoma Likely benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
3-@METHYLGLUTACONIC ACIDURIA, TYPE V 3-Methylglutaconic aciduria BEFREE 16055927, 22797137, 23296368
★☆☆☆☆
Found in Text Mining only
3-@METHYLGLUTACONIC ACIDURIA, TYPE V 3-Methylglutaconic aciduria ORPHANET_DG 16055927
★☆☆☆☆
Found in Text Mining only
3-@METHYLGLUTACONIC ACIDURIA, TYPE V 3-Methylglutaconic aciduria GENOMICS_ENGLAND_DG 16055927, 22797137, 27426421, 27928778
★☆☆☆☆
Found in Text Mining only
3-@METHYLGLUTACONIC ACIDURIA, TYPE V 3-Methylglutaconic aciduria CLINVAR_DG 16055927
★☆☆☆☆
Found in Text Mining only
3-@METHYLGLUTACONIC ACIDURIA, TYPE V 3-Methylglutaconic aciduria CTD_human_DG
★☆☆☆☆
Found in Text Mining only
3-methylglutaconic aciduria type 5 3-Methylglutaconic aciduria GENOMICS_ENGLAND_DG 22797137, 27426421
★★★★★
ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Arachnoid Cysts Arachnoid cyst HPO_DG
★☆☆☆☆
Found in Text Mining only
Ataxia Ataxia Pubtator 27330077 Associate
★☆☆☆☆
Found in Text Mining only
Atrophy/Degeneration affecting the brainstem Brainstem Atrophy HPO_DG
★☆☆☆☆
Found in Text Mining only
Barth Syndrome Barth syndrome Pubtator 16055927 Associate
★☆☆☆☆
Found in Text Mining only