Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	130827
Gene name	Transmembrane protein 182
Gene symbol	TMEM182
Synonyms (NCBI Gene)	-
Chromosome	2
Chromosome location	2q12.1

116

Show/Hide all (116)

miRTarBase ID	miRNA	Experiments
MIRT1433136	hsa-miR-106a	CLIP-seq
MIRT1433137	hsa-miR-106b	CLIP-seq
MIRT1433138	hsa-miR-1257	CLIP-seq
MIRT1433139	hsa-miR-1260	CLIP-seq
MIRT1433140	hsa-miR-1260b	CLIP-seq
MIRT1433141	hsa-miR-1264	CLIP-seq
MIRT1433142	hsa-miR-130a	CLIP-seq
MIRT1433143	hsa-miR-130b	CLIP-seq
MIRT1433144	hsa-miR-17	CLIP-seq
MIRT1433145	hsa-miR-188-3p	CLIP-seq
MIRT1433146	hsa-miR-19a	CLIP-seq
MIRT1433147	hsa-miR-19b	CLIP-seq
MIRT1433148	hsa-miR-20a	CLIP-seq
MIRT1433149	hsa-miR-20b	CLIP-seq
MIRT1433150	hsa-miR-297	CLIP-seq
MIRT1433151	hsa-miR-299-3p	CLIP-seq
MIRT1433152	hsa-miR-301a	CLIP-seq
MIRT1433153	hsa-miR-301b	CLIP-seq
MIRT1433154	hsa-miR-3121-5p	CLIP-seq
MIRT1433155	hsa-miR-3156-3p	CLIP-seq
MIRT1433156	hsa-miR-3163	CLIP-seq
MIRT1433157	hsa-miR-3201	CLIP-seq
MIRT1433158	hsa-miR-3666	CLIP-seq
MIRT1433159	hsa-miR-3667-3p	CLIP-seq
MIRT1433160	hsa-miR-3691-5p	CLIP-seq
MIRT1433161	hsa-miR-4264	CLIP-seq
MIRT1433162	hsa-miR-4266	CLIP-seq
MIRT1433163	hsa-miR-4295	CLIP-seq
MIRT1433164	hsa-miR-4301	CLIP-seq
MIRT1433165	hsa-miR-4491	CLIP-seq
MIRT1433166	hsa-miR-450b-5p	CLIP-seq
MIRT1433167	hsa-miR-454	CLIP-seq
MIRT1433168	hsa-miR-4643	CLIP-seq
MIRT1433169	hsa-miR-4657	CLIP-seq
MIRT1433170	hsa-miR-4659a-3p	CLIP-seq
MIRT1433171	hsa-miR-4659b-3p	CLIP-seq
MIRT1433172	hsa-miR-466	CLIP-seq
MIRT1433173	hsa-miR-4695-5p	CLIP-seq
MIRT1433174	hsa-miR-4752	CLIP-seq
MIRT1433175	hsa-miR-4762-5p	CLIP-seq
MIRT1433176	hsa-miR-4779	CLIP-seq
MIRT1433177	hsa-miR-4789-3p	CLIP-seq
MIRT1433178	hsa-miR-4791	CLIP-seq
MIRT1433179	hsa-miR-4797-3p	CLIP-seq
MIRT1433180	hsa-miR-485-3p	CLIP-seq
MIRT1433181	hsa-miR-519a	CLIP-seq
MIRT1433182	hsa-miR-519b-3p	CLIP-seq
MIRT1433183	hsa-miR-519c-3p	CLIP-seq
MIRT1433184	hsa-miR-519d	CLIP-seq
MIRT1433185	hsa-miR-520g	CLIP-seq
MIRT1433186	hsa-miR-520h	CLIP-seq
MIRT1433187	hsa-miR-548n	CLIP-seq
MIRT1433188	hsa-miR-548t	CLIP-seq
MIRT1433189	hsa-miR-567	CLIP-seq
MIRT1433190	hsa-miR-586	CLIP-seq
MIRT1433191	hsa-miR-622	CLIP-seq
MIRT1433192	hsa-miR-656	CLIP-seq
MIRT1433193	hsa-miR-93	CLIP-seq
MIRT1433138	hsa-miR-1257	CLIP-seq
MIRT2129851	hsa-miR-1298	CLIP-seq
MIRT2129852	hsa-miR-205	CLIP-seq
MIRT2129853	hsa-miR-23a	CLIP-seq
MIRT2129854	hsa-miR-23b	CLIP-seq
MIRT2129855	hsa-miR-23c	CLIP-seq
MIRT2129856	hsa-miR-298	CLIP-seq
MIRT2129857	hsa-miR-5096	CLIP-seq
MIRT2351281	hsa-miR-1253	CLIP-seq
MIRT1433139	hsa-miR-1260	CLIP-seq
MIRT1433140	hsa-miR-1260b	CLIP-seq
MIRT1433141	hsa-miR-1264	CLIP-seq
MIRT2351282	hsa-miR-140-3p	CLIP-seq
MIRT1433145	hsa-miR-188-3p	CLIP-seq
MIRT1433155	hsa-miR-3156-3p	CLIP-seq
MIRT2351283	hsa-miR-3200-3p	CLIP-seq
MIRT1433159	hsa-miR-3667-3p	CLIP-seq
MIRT2351284	hsa-miR-3919	CLIP-seq
MIRT1433164	hsa-miR-4301	CLIP-seq
MIRT2351285	hsa-miR-4463	CLIP-seq
MIRT2351286	hsa-miR-450b-3p	CLIP-seq
MIRT2351287	hsa-miR-4641	CLIP-seq
MIRT2351288	hsa-miR-4713-3p	CLIP-seq
MIRT2351289	hsa-miR-4797-5p	CLIP-seq
MIRT2351290	hsa-miR-549	CLIP-seq
MIRT2351291	hsa-miR-638	CLIP-seq
MIRT2351292	hsa-miR-769-3p	CLIP-seq
MIRT2351293	hsa-miR-944	CLIP-seq
MIRT2645078	hsa-miR-10a	CLIP-seq
MIRT2645079	hsa-miR-10b	CLIP-seq
MIRT2645080	hsa-miR-2115	CLIP-seq
MIRT2645081	hsa-miR-3065-5p	CLIP-seq
MIRT2645082	hsa-miR-3180-5p	CLIP-seq
MIRT2645083	hsa-miR-3188	CLIP-seq
MIRT2645084	hsa-miR-331-3p	CLIP-seq
MIRT2645085	hsa-miR-3612	CLIP-seq
MIRT2645086	hsa-miR-4443	CLIP-seq
MIRT2645087	hsa-miR-4534	CLIP-seq
MIRT2645088	hsa-miR-4802-5p	CLIP-seq
MIRT2645089	hsa-miR-494	CLIP-seq
MIRT2645090	hsa-miR-520a-5p	CLIP-seq
MIRT2645091	hsa-miR-525-5p	CLIP-seq
MIRT2645092	hsa-miR-650	CLIP-seq
MIRT2645078	hsa-miR-10a	CLIP-seq
MIRT2645079	hsa-miR-10b	CLIP-seq
MIRT2645080	hsa-miR-2115	CLIP-seq
MIRT2645081	hsa-miR-3065-5p	CLIP-seq
MIRT2645082	hsa-miR-3180-5p	CLIP-seq
MIRT2645083	hsa-miR-3188	CLIP-seq
MIRT2645084	hsa-miR-331-3p	CLIP-seq
MIRT2645085	hsa-miR-3612	CLIP-seq
MIRT2645086	hsa-miR-4443	CLIP-seq
MIRT2645087	hsa-miR-4534	CLIP-seq
MIRT2645088	hsa-miR-4802-5p	CLIP-seq
MIRT2645089	hsa-miR-494	CLIP-seq
MIRT2645090	hsa-miR-520a-5p	CLIP-seq
MIRT2645091	hsa-miR-525-5p	CLIP-seq
MIRT2645092	hsa-miR-650	CLIP-seq

Show/Hide all (12)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	25416956, 28514442, 32296183, 33961781
GO:0005886	Component	Plasma membrane	IEA
GO:0007517	Process	Muscle organ development	IEA
GO:0014906	Process	Myotube cell development involved in skeletal muscle regeneration	IEA
GO:0014906	Process	Myotube cell development involved in skeletal muscle regeneration	ISS
GO:0014908	Process	Myotube differentiation involved in skeletal muscle regeneration	IEA
GO:0014908	Process	Myotube differentiation involved in skeletal muscle regeneration	ISS
GO:0016020	Component	Membrane	IEA
GO:0045662	Process	Negative regulation of myoblast differentiation	IEA
GO:0045662	Process	Negative regulation of myoblast differentiation	ISS
GO:1901740	Process	Negative regulation of myoblast fusion	IEA
GO:1901740	Process	Negative regulation of myoblast fusion	ISS

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

Q6ZP80

Protein name

Transmembrane protein 182

Protein function

Negatively regulates myogenesis and skeletal muscle regeneration via its association with ITGB1 (By similarity). Modulates ITGB1 activation by decreasing ITGB1-LAMB1 interaction and inhibiting ITGB1-mediated intracellular signaling during myogen

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13903	Claudin_2	15 → 220	PMP-22/EMP/MP20/Claudin tight junction	Family

Sequence

MRLNIAIFFGALFGALGVLLFLVAFGSDYWLLATEVGRCSGEKNIENVTFHHEGFFWRCW
FNGIVEENDSNIWKFWYTNQPPSKNCTHAYLSPYPFMRGEHNSTSYDSAVIYRGFWAVLM
LLGVVAVVIASFLIICAAPFASHFLYKAGGGSYIAAGILFSLVVMLYVIWVQAVADMESY
RNMKMKDCLDFTPSVLYGWSFFLAPAGIFFSLLAGLLFLVVGWHIQIHH

Sequence length

229

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (14)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CUTANEOUS MASTOCYTOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DYSLEXIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EOSINOPHILIC ESOPHAGITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTROPHIC CARDIOMYOPATHY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGODENDROGLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSYCHOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE ABUSE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (7)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Carcinogenesis	Carcinogenesis	Pubtator	30893332	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	39596218	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	23349798		★★★★★ ★☆☆☆☆ Found in Text Mining only
Other and unspecified reactive psychosis	Reactive Psychosis	GWASCAT_DG	24132900		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	GWASCAT_DG	24132900		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	30893332		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	30893332	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

TMEM182 (transmembrane protein 182)