Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	1306
Gene name	Collagen type XV alpha 1 chain
Gene symbol	COL15A1
Synonyms (NCBI Gene)	-
Chromosome	9
Chromosome location	9q22.33
Summary	This gene encodes the alpha chain of type XV collagen, a member of the FACIT collagen family (fibril-associated collagens with interrupted helices). Type XV collagen has a wide tissue distribution but the strongest expression is localized to basement memb

147

Show/Hide all (147)

miRTarBase ID	miRNA	Experiments	Reference
MIRT001925	hsa-miR-29c-3p	Luciferase reporter assayqRT-PCR	18390668
MIRT001925	hsa-miR-29c-3p	Luciferase reporter assay	18390668
MIRT017996	hsa-miR-335-5p	Microarray	18185580
MIRT001925	hsa-miR-29c-3p	Reporter assay;Other	18390668
MIRT029496	hsa-miR-26b-5p	Microarray	19088304
MIRT053740	hsa-miR-29b-3p	Microarray	22942087
MIRT053740	hsa-miR-29b-3p	qRT-PCR	25744716
MIRT902508	hsa-miR-4711-5p	CLIP-seq
MIRT1546621	hsa-miR-186	CLIP-seq
MIRT1546622	hsa-miR-298	CLIP-seq
MIRT1546623	hsa-miR-29a	CLIP-seq
MIRT1546624	hsa-miR-29b	CLIP-seq
MIRT1546625	hsa-miR-29c	CLIP-seq
MIRT1546626	hsa-miR-3074-5p	CLIP-seq
MIRT1546627	hsa-miR-3133	CLIP-seq
MIRT1546628	hsa-miR-3158-5p	CLIP-seq
MIRT1546629	hsa-miR-3613-5p	CLIP-seq
MIRT1546630	hsa-miR-659	CLIP-seq
MIRT1546631	hsa-miR-9	CLIP-seq
MIRT2203519	hsa-miR-1252	CLIP-seq
MIRT2427431	hsa-let-7a	CLIP-seq
MIRT2427432	hsa-let-7b	CLIP-seq
MIRT2427433	hsa-let-7c	CLIP-seq
MIRT2427434	hsa-let-7d	CLIP-seq
MIRT2427435	hsa-let-7e	CLIP-seq
MIRT2427436	hsa-let-7f	CLIP-seq
MIRT2427437	hsa-let-7g	CLIP-seq
MIRT2427438	hsa-let-7i	CLIP-seq
MIRT1546621	hsa-miR-186	CLIP-seq
MIRT2427439	hsa-miR-202	CLIP-seq
MIRT2427440	hsa-miR-2052	CLIP-seq
MIRT2427441	hsa-miR-299-5p	CLIP-seq
MIRT2427442	hsa-miR-3065-5p	CLIP-seq
MIRT1546627	hsa-miR-3133	CLIP-seq
MIRT2427443	hsa-miR-3134	CLIP-seq
MIRT1546629	hsa-miR-3613-5p	CLIP-seq
MIRT2427444	hsa-miR-3659	CLIP-seq
MIRT2427445	hsa-miR-3668	CLIP-seq
MIRT2427446	hsa-miR-4307	CLIP-seq
MIRT2427447	hsa-miR-4328	CLIP-seq
MIRT2427448	hsa-miR-4422	CLIP-seq
MIRT2427449	hsa-miR-4458	CLIP-seq
MIRT2427450	hsa-miR-4461	CLIP-seq
MIRT2427451	hsa-miR-4500	CLIP-seq
MIRT2427452	hsa-miR-4534	CLIP-seq
MIRT2427453	hsa-miR-4658	CLIP-seq
MIRT2427454	hsa-miR-4684-3p	CLIP-seq
MIRT2427455	hsa-miR-4758-5p	CLIP-seq
MIRT2427456	hsa-miR-4764-5p	CLIP-seq
MIRT2427457	hsa-miR-518a-5p	CLIP-seq
MIRT2427458	hsa-miR-527	CLIP-seq
MIRT2427459	hsa-miR-567	CLIP-seq
MIRT2427460	hsa-miR-574-5p	CLIP-seq
MIRT2427461	hsa-miR-654-3p	CLIP-seq
MIRT1546630	hsa-miR-659	CLIP-seq
MIRT1546631	hsa-miR-9	CLIP-seq
MIRT2427462	hsa-miR-98	CLIP-seq
MIRT2506485	hsa-miR-1185	CLIP-seq
MIRT2203519	hsa-miR-1252	CLIP-seq
MIRT2506486	hsa-miR-1305	CLIP-seq
MIRT2506487	hsa-miR-1910	CLIP-seq
MIRT2506488	hsa-miR-219-5p	CLIP-seq
MIRT2506489	hsa-miR-2909	CLIP-seq
MIRT2427441	hsa-miR-299-5p	CLIP-seq
MIRT2506490	hsa-miR-300	CLIP-seq
MIRT2427442	hsa-miR-3065-5p	CLIP-seq
MIRT1546626	hsa-miR-3074-5p	CLIP-seq
MIRT2506491	hsa-miR-3120-5p	CLIP-seq
MIRT2506492	hsa-miR-3147	CLIP-seq
MIRT2506493	hsa-miR-3148	CLIP-seq
MIRT2506494	hsa-miR-3162-5p	CLIP-seq
MIRT2506495	hsa-miR-3163	CLIP-seq
MIRT2506496	hsa-miR-3170	CLIP-seq
MIRT2506497	hsa-miR-3173-3p	CLIP-seq
MIRT2506498	hsa-miR-3647-3p	CLIP-seq
MIRT2427445	hsa-miR-3668	CLIP-seq
MIRT2506499	hsa-miR-3679-5p	CLIP-seq
MIRT2506500	hsa-miR-3688-3p	CLIP-seq
MIRT2506501	hsa-miR-377	CLIP-seq
MIRT2506502	hsa-miR-381	CLIP-seq
MIRT2506503	hsa-miR-3935	CLIP-seq
MIRT2506504	hsa-miR-410	CLIP-seq
MIRT2506505	hsa-miR-4274	CLIP-seq
MIRT2506506	hsa-miR-4282	CLIP-seq
MIRT2427446	hsa-miR-4307	CLIP-seq
MIRT2506507	hsa-miR-4330	CLIP-seq
MIRT2427448	hsa-miR-4422	CLIP-seq
MIRT2506508	hsa-miR-4425	CLIP-seq
MIRT2506509	hsa-miR-4445	CLIP-seq
MIRT2506510	hsa-miR-4468	CLIP-seq
MIRT2506511	hsa-miR-450b-3p	CLIP-seq
MIRT2506512	hsa-miR-4517	CLIP-seq
MIRT2506513	hsa-miR-4659a-5p	CLIP-seq
MIRT2506514	hsa-miR-4659b-5p	CLIP-seq
MIRT2506515	hsa-miR-4661-3p	CLIP-seq
MIRT2506516	hsa-miR-4666-3p	CLIP-seq
MIRT2506517	hsa-miR-4666-5p	CLIP-seq
MIRT2506518	hsa-miR-4668-3p	CLIP-seq
MIRT2506519	hsa-miR-4668-5p	CLIP-seq
MIRT902508	hsa-miR-4711-5p	CLIP-seq
MIRT2506520	hsa-miR-4731-5p	CLIP-seq
MIRT2506521	hsa-miR-4781-3p	CLIP-seq
MIRT2506522	hsa-miR-4782-3p	CLIP-seq
MIRT2506523	hsa-miR-4789-5p	CLIP-seq
MIRT2506524	hsa-miR-4802-3p	CLIP-seq
MIRT2506525	hsa-miR-508-3p	CLIP-seq
MIRT2506526	hsa-miR-548c-3p	CLIP-seq
MIRT2506527	hsa-miR-579	CLIP-seq
MIRT2506528	hsa-miR-769-3p	CLIP-seq
MIRT2506485	hsa-miR-1185	CLIP-seq
MIRT2203519	hsa-miR-1252	CLIP-seq
MIRT2506486	hsa-miR-1305	CLIP-seq
MIRT2506488	hsa-miR-219-5p	CLIP-seq
MIRT2506489	hsa-miR-2909	CLIP-seq
MIRT1546622	hsa-miR-298	CLIP-seq
MIRT2427441	hsa-miR-299-5p	CLIP-seq
MIRT2427442	hsa-miR-3065-5p	CLIP-seq
MIRT1546626	hsa-miR-3074-5p	CLIP-seq
MIRT2506491	hsa-miR-3120-5p	CLIP-seq
MIRT2506492	hsa-miR-3147	CLIP-seq
MIRT2506493	hsa-miR-3148	CLIP-seq
MIRT1546628	hsa-miR-3158-5p	CLIP-seq
MIRT2506494	hsa-miR-3162-5p	CLIP-seq
MIRT2506495	hsa-miR-3163	CLIP-seq
MIRT2506496	hsa-miR-3170	CLIP-seq
MIRT2506497	hsa-miR-3173-3p	CLIP-seq
MIRT2506499	hsa-miR-3679-5p	CLIP-seq
MIRT2506501	hsa-miR-377	CLIP-seq
MIRT2506504	hsa-miR-410	CLIP-seq
MIRT2506506	hsa-miR-4282	CLIP-seq
MIRT2427448	hsa-miR-4422	CLIP-seq
MIRT2506508	hsa-miR-4425	CLIP-seq
MIRT2506509	hsa-miR-4445	CLIP-seq
MIRT2506511	hsa-miR-450b-3p	CLIP-seq
MIRT2506512	hsa-miR-4517	CLIP-seq
MIRT2506513	hsa-miR-4659a-5p	CLIP-seq
MIRT2506514	hsa-miR-4659b-5p	CLIP-seq
MIRT2506515	hsa-miR-4661-3p	CLIP-seq
MIRT2506519	hsa-miR-4668-5p	CLIP-seq
MIRT902508	hsa-miR-4711-5p	CLIP-seq
MIRT2506520	hsa-miR-4731-5p	CLIP-seq
MIRT2506521	hsa-miR-4781-3p	CLIP-seq
MIRT2506522	hsa-miR-4782-3p	CLIP-seq
MIRT2506525	hsa-miR-508-3p	CLIP-seq
MIRT2506526	hsa-miR-548c-3p	CLIP-seq
MIRT2506527	hsa-miR-579	CLIP-seq
MIRT2506528	hsa-miR-769-3p	CLIP-seq

Show/Hide all (22)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001525	Process	Angiogenesis	IEA
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005581	Component	Collagen trimer	IEA
GO:0005582	Component	Collagen type XV trimer	TAS	9651385
GO:0005604	Component	Basement membrane	IBA
GO:0005604	Component	Basement membrane	IEA
GO:0005615	Component	Extracellular space	HDA	20551380
GO:0005783	Component	Endoplasmic reticulum	IDA
GO:0005788	Component	Endoplasmic reticulum lumen	IEA
GO:0005788	Component	Endoplasmic reticulum lumen	TAS
GO:0007155	Process	Cell adhesion	IEA
GO:0007165	Process	Signal transduction	NAS
GO:0016020	Component	Membrane	NAS
GO:0030020	Function	Extracellular matrix structural constituent conferring tensile strength	IBA
GO:0030020	Function	Extracellular matrix structural constituent conferring tensile strength	ISS
GO:0030020	Function	Extracellular matrix structural constituent conferring tensile strength	RCA	20551380, 25037231, 27068509, 27559042, 28675934
GO:0030154	Process	Cell differentiation	IEA
GO:0031012	Component	Extracellular matrix	HDA	20551380
GO:0031012	Component	Extracellular matrix	HDA	25037231, 27068509, 27559042, 28675934
GO:0031012	Component	Extracellular matrix	ISS	22261194
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145

MIM	HGNC	e!Ensembl
120325	2192	ENSG00000204291

P39059

Protein name

Collagen alpha-1(XV) chain [Cleaved into: Restin (Endostatin-XV) (Related to endostatin) (Restin-I); Restin-2 (Restin-II); Restin-3 (Restin-III); Restin-4 (Restin-IV)]

Protein function

Structural protein that stabilizes microvessels and muscle cells, both in heart and in skeletal muscle. ; Restin potently inhibits angiogenesis.

PDB

3N3F

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13385	Laminin_G_3	76 → 235		Domain
PF01391	Collagen	617 → 681	Collagen triple helix repeat (20 copies)	Repeat
PF01391	Collagen	673 → 735	Collagen triple helix repeat (20 copies)	Repeat
PF01391	Collagen	820 → 868	Collagen triple helix repeat (20 copies)	Repeat
PF01391	Collagen	877 → 929	Collagen triple helix repeat (20 copies)	Repeat
PF06482	Endostatin	1133 → 1200	Collagenase NC10 and Endostatin	Domain
PF06482	Endostatin	1192 → 1383	Collagenase NC10 and Endostatin	Domain

Tissue specificity

TISSUE SPECIFICITY: Detected in fibroblasts and urine (at protein level) (PubMed:25326458, PubMed:36213313, PubMed:37453717). Detected in placenta (at protein level) (PubMed:32337544). Expressed predominantly in internal organs such as adrenal gland, panc

Sequence

MAPRRNNGQCWCLLMLLSVSTPLPAVTQTRGATETASQGHLDLTQLIGVPLPSSVSFVTG
YGGFPAYSFGPGANVGRPARTLIPSTFFRDFAISVVVKPSSTRGGVLFAITDAFQKVIYL
GLRLSGVEDGHQRIILYYTEPGSHVSQEAAAFSVPVMTHRWNRFAMIVQGEEVTLLVNCE
EHSRIPFQRSSQALAFESSAGIFMGNAGATGLERFTGSLQQLTVHPDPRTPEELCDPEES
SASGETSGLQEADGVAEILEAVTYTQASPKEAKVEPINTPPTPSSPFEDMELSGEPVPEG
TLETTNMSIIQHSSPKQGSGEILNDTLEGVHSVDGDPITDSGSGAGAFLDIAEEKNLAAT
AAGLAEVPISTAGEAEASSVPTGGPTLSMSTENPEEGVTPGPDNEERLAATAAGEAEALA
SMPGEVEASGVAPGELDLSMSAQSLGEEATVGPSSEDSLTTAAAATEVSLSTFEDEEASG
VPTDGLAPLTATMAPERAVTSGPGDEEDLAAATTEEPLITAGGEESGSPPPDGPPLPLPT
VAPERWITPAQREHVGMKGQAGPKGEKGDAGEELPGPPEPSGPVGPTAGAEAEGSGLGWG
SDVGSGSGDLVGSEQLLRGPPGPPGPPGLPGIPGKPGTDVFMGPPGSPGEDGPAGEPGPP
GPEGQPGVDGATGLPGMKGEKGARGPNGSVGEKGDPGNRGLPGPPGKKGQAGPPGVMGPP
GPPGPPGPPGPGCTMGLGFEDTEGSGSTQLLNEPKLSRPTAAIGLKGEKGDRGPKGERGM
DGASIVGPPGPRGPPGHIKVLSNSLINITHGFMNFSDIPELVGPPGPDGLPGLPGFPGPR
GPKGDTGLPGFPGLKGEQGEKGEPGAILTEDIPLERLMGKKGEPGMHGAPGPMGPKGPPG
HKGEFGLPGRPGRPGLNGLKGTKGDPGVIMQGPPGLPGPPGPPGPPGAVINIKGAIFPIP
VRPHCKMPVDTAHPGSPELITFHGVKGEKGSWGLPGSKGEKGDQGAQGPPGPPLDLAYLR
HFLNNLKGENGDKGFKGEKGEKGDINGSFLMSGPPGLPGNPGPAGQKGETVVGPQGPPGA
PGLPGPPGFGRPGDPGPPGPPGPPGPPAILGAAVALPGPPGPPGQPGLPGSRNLVTAFSN
MDDMLQKAHLVIEGTFIYLRDSTEFFIRVRDGWKKLQLGELIPIPADSPPPPALSSNPHQ
LLPPPNPISSANYEKPALHLAALNMPFSGDIRADFQCFKQARAAGLLSTYRAFLSSHLQD
LSTIVRKAERYSLPIVNLKGQVLFNNWDSIFSGHGGQFNMHIPIYSFDGRDIMTDPSWPQ
KVIWHGSSPHGVRLVDNYCEAWRTADTAVTGLASPLSTGKILDQKAYSCANRLIVLCIEN
SFMTDARK

Sequence length

1388

Interactions

View interactions

	KEGG		Reactome
	Protein digestion and absorption		Collagen degradation Collagen biosynthesis and modifying enzymes Assembly of collagen fibrils and other multimeric structures Collagen chain trimerization

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (12)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BONE FRACTURE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COL15A1-related disorder	Likely benign; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MALIGNANT EPITHELIAL TUMOR OF OVARY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RESPIRATORY SYSTEM DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (37)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Alveolar capillary dysplasia	Alveolar capillary dysplasia	Pubtator	38029923	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Thoracic	Thoracic aortic aneurysm	Pubtator	28550590	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	23912340, 28283548		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	31952466	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	BEFREE	23912340, 28283548		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	23912340	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	37967346	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
BASAL LAMINAR DRUSEN (disorder)	Basal Laminar Drusen	BEFREE	27007659		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	25972084		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	25134534	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	20154727	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	25134534		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	20154727		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	20060954		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	GWASCAT_DG	30595370		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	25134534		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	GWASCAT_DG	25134534		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma, Primary Open Angle	Glaucoma	BEFREE	23621901		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	12433698, 1450414, 1600942, 8161933		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	25433555		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	31952466	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ki-1+ Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	BEFREE	1450414, 8161933		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	GWASCAT_DG	27903959		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	26293333		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	28284560		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	38029923	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	33618707	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	25972084		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	29610475		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10049780, 25972084, 26293333		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuromuscular Diseases	Neuromuscular Diseases	BEFREE	26937007		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	20060954	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	29610475		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	34012494	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	20154727		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcopenia	Sarcopenia	Pubtator	38644354	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
SMITH-MCCORT DYSPLASIA 1	Smith-McCort Dysplasia	BEFREE	23912340		★★★★★ ★☆☆☆☆ Found in Text Mining only

COL15A1 (collagen type XV alpha 1 chain)