Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	130367
Gene name	Sphingosine-1-phosphate phosphatase 2
Gene symbol	SGPP2
Synonyms (NCBI Gene)	SPP2SPPase2
Chromosome	2
Chromosome location	2q36.1
Summary	The protein encoded by this gene is a transmembrane protein that degrades the bioactive signaling molecule sphingosine 1-phosphate. The encoded protein is induced during inflammatory responses and has been shown to be downregulated by the microRNA-31 tumo

Show/Hide all (91)

miRTarBase ID	miRNA	Experiments	Reference
MIRT048643	hsa-miR-99a-5p	CLASH	23622248
MIRT629725	hsa-miR-181d-3p	HITS-CLIP	23824327
MIRT629724	hsa-miR-6890-3p	HITS-CLIP	23824327
MIRT629723	hsa-miR-6741-3p	HITS-CLIP	23824327
MIRT629722	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT629721	hsa-miR-1307-3p	HITS-CLIP	23824327
MIRT629720	hsa-miR-4638-5p	HITS-CLIP	23824327
MIRT629719	hsa-miR-2276-3p	HITS-CLIP	23824327
MIRT629718	hsa-miR-4284	HITS-CLIP	23824327
MIRT629717	hsa-miR-572	HITS-CLIP	23824327
MIRT544886	hsa-miR-3662	PAR-CLIP	21572407
MIRT544885	hsa-miR-3163	PAR-CLIP	21572407
MIRT544884	hsa-miR-410-3p	PAR-CLIP	21572407
MIRT544883	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT544882	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT544881	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT458657	hsa-miR-3940-3p	PAR-CLIP	23592263
MIRT458656	hsa-miR-1910-3p	PAR-CLIP	23592263
MIRT458655	hsa-miR-6511a-5p	PAR-CLIP	23592263
MIRT458654	hsa-miR-6808-5p	PAR-CLIP	23592263
MIRT458653	hsa-miR-6893-5p	PAR-CLIP	23592263
MIRT458652	hsa-miR-940	PAR-CLIP	23592263
MIRT458651	hsa-miR-4459	PAR-CLIP	23592263
MIRT458650	hsa-miR-4742-5p	PAR-CLIP	23592263
MIRT458648	hsa-miR-4269	PAR-CLIP	23592263
MIRT458649	hsa-miR-6715b-5p	PAR-CLIP	23592263
MIRT458647	hsa-miR-4514	PAR-CLIP	23592263
MIRT458646	hsa-miR-4692	PAR-CLIP	23592263
MIRT458645	hsa-miR-1247-3p	PAR-CLIP	23592263
MIRT458644	hsa-miR-5186	PAR-CLIP	23592263
MIRT458643	hsa-miR-1225-3p	PAR-CLIP	23592263
MIRT458642	hsa-miR-1233-3p	PAR-CLIP	23592263
MIRT458641	hsa-miR-3160-3p	PAR-CLIP	23592263
MIRT458640	hsa-miR-558	PAR-CLIP	23592263
MIRT458639	hsa-miR-4487	PAR-CLIP	23592263
MIRT458638	hsa-miR-1827	PAR-CLIP	23592263
MIRT458637	hsa-miR-4722-5p	PAR-CLIP	23592263
MIRT458636	hsa-miR-6499-3p	PAR-CLIP	23592263
MIRT458635	hsa-miR-6894-5p	PAR-CLIP	23592263
MIRT458634	hsa-miR-3612	PAR-CLIP	23592263
MIRT458633	hsa-miR-650	PAR-CLIP	23592263
MIRT458632	hsa-miR-6807-5p	PAR-CLIP	23592263
MIRT458631	hsa-miR-455-3p	PAR-CLIP	23592263
MIRT458630	hsa-miR-1273e	PAR-CLIP	23592263
MIRT458629	hsa-miR-550b-2-5p	PAR-CLIP	23592263
MIRT458628	hsa-miR-6516-5p	PAR-CLIP	23592263
MIRT629725	hsa-miR-181d-3p	HITS-CLIP	23824327
MIRT629724	hsa-miR-6890-3p	HITS-CLIP	23824327
MIRT629723	hsa-miR-6741-3p	HITS-CLIP	23824327
MIRT629722	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT629721	hsa-miR-1307-3p	HITS-CLIP	23824327
MIRT629720	hsa-miR-4638-5p	HITS-CLIP	23824327
MIRT629719	hsa-miR-2276-3p	HITS-CLIP	23824327
MIRT629718	hsa-miR-4284	HITS-CLIP	23824327
MIRT629717	hsa-miR-572	HITS-CLIP	23824327
MIRT544886	hsa-miR-3662	PAR-CLIP	21572407
MIRT544885	hsa-miR-3163	PAR-CLIP	21572407
MIRT544884	hsa-miR-410-3p	PAR-CLIP	21572407
MIRT544883	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT544882	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT544881	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT458657	hsa-miR-3940-3p	PAR-CLIP	23592263
MIRT458656	hsa-miR-1910-3p	PAR-CLIP	23592263
MIRT458655	hsa-miR-6511a-5p	PAR-CLIP	23592263
MIRT458654	hsa-miR-6808-5p	PAR-CLIP	23592263
MIRT458653	hsa-miR-6893-5p	PAR-CLIP	23592263
MIRT458652	hsa-miR-940	PAR-CLIP	23592263
MIRT458651	hsa-miR-4459	PAR-CLIP	23592263
MIRT458650	hsa-miR-4742-5p	PAR-CLIP	23592263
MIRT458648	hsa-miR-4269	PAR-CLIP	23592263
MIRT458649	hsa-miR-6715b-5p	PAR-CLIP	23592263
MIRT458647	hsa-miR-4514	PAR-CLIP	23592263
MIRT458646	hsa-miR-4692	PAR-CLIP	23592263
MIRT458645	hsa-miR-1247-3p	PAR-CLIP	23592263
MIRT458644	hsa-miR-5186	PAR-CLIP	23592263
MIRT458643	hsa-miR-1225-3p	PAR-CLIP	23592263
MIRT458642	hsa-miR-1233-3p	PAR-CLIP	23592263
MIRT458641	hsa-miR-3160-3p	PAR-CLIP	23592263
MIRT458640	hsa-miR-558	PAR-CLIP	23592263
MIRT458639	hsa-miR-4487	PAR-CLIP	23592263
MIRT458638	hsa-miR-1827	PAR-CLIP	23592263
MIRT458637	hsa-miR-4722-5p	PAR-CLIP	23592263
MIRT458636	hsa-miR-6499-3p	PAR-CLIP	23592263
MIRT458635	hsa-miR-6894-5p	PAR-CLIP	23592263
MIRT458634	hsa-miR-3612	PAR-CLIP	23592263
MIRT458633	hsa-miR-650	PAR-CLIP	23592263
MIRT458632	hsa-miR-6807-5p	PAR-CLIP	23592263
MIRT458631	hsa-miR-455-3p	PAR-CLIP	23592263
MIRT458630	hsa-miR-1273e	PAR-CLIP	23592263
MIRT458629	hsa-miR-550b-2-5p	PAR-CLIP	23592263
MIRT458628	hsa-miR-6516-5p	PAR-CLIP	23592263

Show/Hide all (21)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005783	Component	Endoplasmic reticulum	IDA	12411432
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IBA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006670	Process	Sphingosine metabolic process	IBA
GO:0006670	Process	Sphingosine metabolic process	IDA	12411432
GO:0016020	Component	Membrane	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0030149	Process	Sphingolipid catabolic process	IEA
GO:0030149	Process	Sphingolipid catabolic process	TAS
GO:0042392	Function	Sphingosine-1-phosphate phosphatase activity	IBA
GO:0042392	Function	Sphingosine-1-phosphate phosphatase activity	IDA	12411432
GO:0042392	Function	Sphingosine-1-phosphate phosphatase activity	IEA
GO:0042392	Function	Sphingosine-1-phosphate phosphatase activity	IMP	27059959
GO:0042392	Function	Sphingosine-1-phosphate phosphatase activity	TAS
GO:0046839	Process	Phospholipid dephosphorylation	IBA
GO:0061469	Process	Regulation of type B pancreatic cell proliferation	IEA
GO:0061469	Process	Regulation of type B pancreatic cell proliferation	ISS
GO:0070780	Function	Dihydrosphingosine-1-phosphate phosphatase activity	IEA

MIM	HGNC	e!Ensembl
612827	19953	ENSG00000163082

Q8IWX5

Protein name

Sphingosine-1-phosphate phosphatase 2 (SPPase2) (Spp2) (hSPP2) (EC 3.1.3.-) (Sphingosine-1-phosphatase 2)

Protein function

Has specific phosphohydrolase activity towards sphingoid base 1-phosphates. Has high phosphohydrolase activity against dihydrosphingosine-1-phosphate and sphingosine-1-phosphate (S1P) in vitro (PubMed:12411432). Sphingosine-1-phosphate phosphata

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01569	PAP2	118 → 239	PAP2 superfamily	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed strongly in kidney and heart, followed by brain, colon, small intestine and lung. Not detected in skeletal muscle, thymus, spleen, liver, placenta, and peripheral blood leukocytes. {ECO:0000269|PubMed:12411432}.

Sequence

MAELLRSLQDSQLVARFQRRCGLFPAPDEGPRENGADPTERAARVPGVEHLPAANGKGGE
APANGLRRAAAPEAYVQKYVVKNYFYYYLFQFSAALGQEVFYITFLPFTHWNIDPYLSRR
LIIIWVLVMYIGQVAKDVLKWPRPSSPPVVKLEKRLIAEYGMPSTHAMAATAIAFTLLIS
TMDRYQYPFVLGLVMAVVFSTLVCLSRLYTGMHTVLDVLGGVLITALLIVLTYPAWTFID
CLDSASPLFPVCVIVVPFFLCYNYPVSDYYSPTRADTTTILAAGAGVTIGFWINHFFQLV
SKPAESLPVIQNIPPLTTYMLVLGLTKFAVGIVLILLVRQLVQNLSLQVLYSWFKVVTRN
KEARRRLEIEVPYKFVTYTSVGICATTFVPMLHRFLGLP

Sequence length

399

Interactions

View interactions

	KEGG		Reactome
	Sphingolipid metabolism Metabolic pathways Sphingolipid signaling pathway		Sphingolipid de novo biosynthesis

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ANOREXIA NERVOSA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EATING DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TOURETTE SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (34)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Asthma	Asthma	Pubtator	35570583	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	38448371	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	35795669	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	38448371	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	31849319	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	32443377, 33051418, 38057871, 38448371	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	27130484		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	26530476	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	31849319		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	35795669	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	26530476	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	31849319		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	31849319		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	22277765, 31849319	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	22277765		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	22277765	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	26530476	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	27130484		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	17113265		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	31849319	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	28286322, 30755830		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	38448371	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	31849319		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	31849319		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	26494556		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	26494556, 31849319		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	31849319		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	31849319	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	35795669	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	26494556, 28286322		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	31849319		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	31849319	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	26494556		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	27130484		★★★★★ ★☆☆☆☆ Found in Text Mining only

SGPP2 (sphingosine-1-phosphate phosphatase 2)