REG3G (regenerating family member 3 gamma)

Gene

• Entrez ID: 130120
• Gene name: Regenerating family member 3 gamma
• Gene symbol: REG3G
• Synonyms (NCBI Gene): LPPM429, PAP IB, PAP-1B, PAP1B, PAPIB, REG III, REG-III, UNQ429
• Chromosome: 2
• Chromosome location: 2p12
• Summary: This gene encodes a member of the regenerating islet-derived genes (REG)3 protein family. These proteins are secreted, C-type lectins with a carbohydrate recognition domain and N-terminal signal peptide. The protein encoded by this gene is an antimicrobia

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1299967	hsa-miR-142-5p	CLIP-seq
MIRT1299968	hsa-miR-3143	CLIP-seq
MIRT1299969	hsa-miR-340	CLIP-seq
MIRT1299970	hsa-miR-543	CLIP-seq
MIRT1299971	hsa-miR-548a-5p	CLIP-seq
MIRT1299972	hsa-miR-548ab	CLIP-seq
MIRT1299973	hsa-miR-548ak	CLIP-seq
MIRT1299974	hsa-miR-548b-5p	CLIP-seq
MIRT1299975	hsa-miR-548c-5p	CLIP-seq
MIRT1299976	hsa-miR-548d-5p	CLIP-seq
MIRT1299977	hsa-miR-548h	CLIP-seq
MIRT1299978	hsa-miR-548i	CLIP-seq
MIRT1299979	hsa-miR-548j	CLIP-seq
MIRT1299980	hsa-miR-548k	CLIP-seq
MIRT1299981	hsa-miR-548l	CLIP-seq
MIRT1299982	hsa-miR-548w	CLIP-seq
MIRT1299983	hsa-miR-548y	CLIP-seq
MIRT1299984	hsa-miR-559	CLIP-seq
MIRT1299985	hsa-miR-802	CLIP-seq
MIRT2089198	hsa-miR-3617	CLIP-seq
MIRT2089199	hsa-miR-641	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002755	Process	MyD88-dependent toll-like receptor signaling pathway	ISS
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0006953	Process	Acute-phase response	IEA
GO:0006954	Process	Inflammatory response	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IBA
GO:0010838	Process	Positive regulation of keratinocyte proliferation	ISS
GO:0030246	Function	Carbohydrate binding	IEA
GO:0038023	Function	Signaling receptor activity	IBA
GO:0042834	Function	Peptidoglycan binding	IBA
GO:0042834	Function	Peptidoglycan binding	IDA	16931762
GO:0043434	Process	Response to peptide hormone	IBA
GO:0045617	Process	Negative regulation of keratinocyte differentiation	ISS
GO:0046872	Function	Metal ion binding	IEA
GO:0050830	Process	Defense response to Gram-positive bacterium	ISS
GO:0061844	Process	Antimicrobial humoral immune response mediated by antimicrobial peptide	IBA
GO:0061844	Process	Antimicrobial humoral immune response mediated by antimicrobial peptide	IDA	16931762
GO:0070492	Function	Oligosaccharide binding	IBA
GO:0070492	Function	Oligosaccharide binding	IDA	16931762
GO:0090303	Process	Positive regulation of wound healing	ISS

Other IDs

• MIM: 609933
• HGNC: 29595
• e!Ensembl: ENSG00000143954

Protein

• UniProt ID: Q6UW15
• Protein name: Regenerating islet-derived protein 3-gamma (REG-3-gamma) (Pancreatitis-associated protein 1B) (PAP-1B) (Pancreatitis-associated protein IB) (PAP IB) (Regenerating islet-derived protein III-gamma) (REG III) (Reg III-gamma) [Cleaved into: Regenerating islet
• Protein function: Bactericidal C-type lectin which acts exclusively against Gram-positive bacteria and mediates bacterial killing by binding to surface-exposed carbohydrate moieties of peptidoglycan. Restricts bacterial colonization of the intestinal epithelial s
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00059	Lectin_C	57 → 173	Lectin C-type domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Predominantly expressed in pancreas, where it may be restricted to exocrine pancreas. Moderate expression levels in testis and weak in heart, kidney and placenta. {ECO:0000269|PubMed:15556304, ECO:0000269|PubMed:15777617}.
• Sequence:

  MLPPMALPSVSWMLLSCLILLCQVQGEETQKELPSPRISCPKGSKAYGSPCYALFLSPKS
  WMDADLACQKRPSGKLVSVLSGAEGSFVSSLVRSISNSYSYIWIGLHDPTQGSEPDGDGW
  EWSSTDVMNYFAWEKNPSTILNPGHCGSLSRSTGFLKWKDYNCDAKLPYVCKFKD

• Sequence length: 175

Pathways

Reactome:

Antimicrobial peptides

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEVELOPMENTAL DYSPLASIA OF THE HIP	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	28880262		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	34930787	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	24065141		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	27524110		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	32842596	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	35395711	Associate	★☆☆☆☆ Found in Text Mining only
Cystitis	Cystitis	BEFREE	26658437		★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	26867181		★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	23743605		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	CTD_human_DG	27798352		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	23743605		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	24065141		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	28880262		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	28880262		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	28880262		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	28880262		★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	BEFREE	28880262		★☆☆☆☆ Found in Text Mining only
Pyelonephritis	Pyelonephritis	BEFREE	26658437		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	33923774	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	31059079		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	26867181, 30448775		★☆☆☆☆ Found in Text Mining only