AADAC (arylacetamide deacetylase)

Gene

• Entrez ID: 13
• Gene name: Arylacetamide deacetylase
• Gene symbol: AADAC
• Synonyms (NCBI Gene): CES5A1, DAC
• Chromosome: 3
• Chromosome location: 3q25.1
• Summary: Microsomal arylacetamide deacetylase competes against the activity of cytosolic arylamine N-acetyltransferase, which catalyzes one of the initial biotransformation pathways for arylamine and heterocyclic amine carcinogens [provided by RefSeq, Jul 2008]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT621349	hsa-miR-1179	HITS-CLIP	23824327
MIRT621348	hsa-miR-8062	HITS-CLIP	23824327
MIRT630652	hsa-miR-487a-5p	HITS-CLIP	23824327
MIRT630651	hsa-miR-487b-5p	HITS-CLIP	23824327
MIRT621347	hsa-miR-374b-3p	HITS-CLIP	23824327
MIRT621349	hsa-miR-1179	HITS-CLIP	23824327
MIRT630652	hsa-miR-487a-5p	HITS-CLIP	23824327
MIRT630651	hsa-miR-487b-5p	HITS-CLIP	23824327
MIRT621347	hsa-miR-374b-3p	HITS-CLIP	23824327
MIRT621349	hsa-miR-1179	HITS-CLIP	23824327
MIRT621348	hsa-miR-8062	HITS-CLIP	23824327
MIRT621347	hsa-miR-374b-3p	HITS-CLIP	23824327
MIRT450596	hsa-miR-4668-3p	PAR-CLIP	22100165
MIRT450597	hsa-miR-323a-3p	PAR-CLIP	22100165
MIRT450595	hsa-miR-3163	PAR-CLIP	22100165
MIRT450594	hsa-miR-5585-3p	PAR-CLIP	22100165
MIRT450593	hsa-miR-489-3p	PAR-CLIP	22100165
MIRT621349	hsa-miR-1179	HITS-CLIP	23824327
MIRT621348	hsa-miR-8062	HITS-CLIP	23824327
MIRT630652	hsa-miR-487a-5p	HITS-CLIP	23824327
MIRT630651	hsa-miR-487b-5p	HITS-CLIP	23824327
MIRT621347	hsa-miR-374b-3p	HITS-CLIP	23824327
MIRT621349	hsa-miR-1179	HITS-CLIP	23824327
MIRT630652	hsa-miR-487a-5p	HITS-CLIP	23824327
MIRT630651	hsa-miR-487b-5p	HITS-CLIP	23824327
MIRT621347	hsa-miR-374b-3p	HITS-CLIP	23824327
MIRT621349	hsa-miR-1179	HITS-CLIP	23824327
MIRT621348	hsa-miR-8062	HITS-CLIP	23824327
MIRT621347	hsa-miR-374b-3p	HITS-CLIP	23824327
MIRT450596	hsa-miR-4668-3p	PAR-CLIP	22100165
MIRT450597	hsa-miR-323a-3p	PAR-CLIP	22100165
MIRT450595	hsa-miR-3163	PAR-CLIP	22100165
MIRT450594	hsa-miR-5585-3p	PAR-CLIP	22100165
MIRT450593	hsa-miR-489-3p	PAR-CLIP	22100165
MIRT756695	hsa-miR-188-3p	CLIP-seq
MIRT756696	hsa-miR-203	CLIP-seq
MIRT756697	hsa-miR-3646	CLIP-seq
MIRT756698	hsa-miR-605	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003824	Function	Catalytic activity	IEA
GO:0003824	Function	Catalytic activity	TAS	8063807
GO:0004806	Function	Triacylglycerol lipase activity	IBA
GO:0004806	Function	Triacylglycerol lipase activity	IEA
GO:0004806	Function	Triacylglycerol lipase activity	ISS
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IBA
GO:0005789	Component	Endoplasmic reticulum membrane	IDA	10318829, 15152005, 19339378
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006805	Process	Xenobiotic metabolic process	TAS
GO:0010898	Process	Positive regulation of triglyceride catabolic process	IBA
GO:0010898	Process	Positive regulation of triglyceride catabolic process	IEA
GO:0010898	Process	Positive regulation of triglyceride catabolic process	ISS
GO:0016020	Component	Membrane	IEA
GO:0016298	Function	Lipase activity	TAS	11481320
GO:0016787	Function	Hydrolase activity	IEA
GO:0017171	Function	Serine hydrolase activity	IBA
GO:0017171	Function	Serine hydrolase activity	IDA	17936933
GO:0017171	Function	Serine hydrolase activity	IEA
GO:0019213	Function	Deacetylase activity	IDA	9665742
GO:0019213	Function	Deacetylase activity	TAS
GO:0052689	Function	Carboxylic ester hydrolase activity	IEA

Other IDs

• MIM: 600338
• HGNC: 17
• e!Ensembl: ENSG00000114771

Protein

• UniProt ID: P22760
• Protein name: Arylacetamide deacetylase (EC 3.1.1.3)
• Protein function: Displays cellular triglyceride lipase activity in liver, increases the levels of intracellular fatty acids derived from the hydrolysis of newly formed triglyceride stores and plays a role in very low-density lipoprotein assembly. Displays serine
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF07859	Abhydrolase_3	107 → 279	alpha/beta hydrolase fold	Domain
  PF07859	Abhydrolase_3	301 → 377	alpha/beta hydrolase fold	Domain

• Tissue specificity: TISSUE SPECIFICITY: Detected in liver (at protein level). Mainly expressed in liver, small intestine, colon, adrenal gland and bladder. {ECO:0000269|PubMed:19339378, ECO:0000269|PubMed:22207054, ECO:0000269|PubMed:22415931}.
• Sequence:

  MGRKSLYLLIVGILIAYYIYTPLPDNVEEPWRMMWINAHLKTIQNLATFVELLGLHHFMD
  SFKVVGSFDEVPPTSDENVTVTETKFNNILVRVYVPKRKSEALRRGLFYIHGGGWCVGSA
  ALSGYDLLSRWTADRLDAVVVSTNYRLAPKYHFPIQFEDVYNALRWFLRKKVLAKYGVNP
  ERIGISGDSAGGNLAAAVTQQLLDDPDVKIKLKIQSLIYPALQPLDVDLPSYQENSNFLF
  LSKSLMVRFWSEYFTTDRSLEKAMLSRQHVPVESSHLFKFVNWSSLLPERFIKGHVYNNP
  NYGSSELAKKYPGFLDVRAAPLLADDNKLRGLPLTYVITCQYDLLRDDGLMYVTRLRNTG
  VQVTHNHVEDGFHGAFSFLGLKISHRLINQYIEWLKENL

• Sequence length: 399

Pathways

Reactome:

Phase I - Functionalization of compounds

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
GILLES DE LA TOURETTE SYNDROME	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	31661339		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	24665856		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	22076154		★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	24665856		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	25611377		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	22429346		★☆☆☆☆ Found in Text Mining only
Chronic myeloproliferative disorder	Myeloproliferative disorder	BEFREE	30964202		★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	20528790		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	25611377		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	23975733		★☆☆☆☆ Found in Text Mining only
Gilles de la Tourette syndrome	Tourette Syndrome	BEFREE	26444075, 29253601		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hemoglobinopathies	Hemoglobinopathy	BEFREE	16292549		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	37032592	Inhibit	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	33532040	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	33532040	Inhibit	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	16193303, 22517724, 23660386, 25611377, 26149802, 28404876, 30210693, 30793488, 31661339		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	19654421, 25649327		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	20528790		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	19654421		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	22076154		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	25611377		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of testis	Malignant Neoplasm Of Testis	BEFREE	24584817		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	24665856		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	25566693, 30593524, 30797153		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	25611377		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	27623509		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	28387383, 28450896, 28803486		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis, Relapsing-Remitting	Multiple Sclerosis	BEFREE	28387383, 28707278		★☆☆☆☆ Found in Text Mining only
Myelodysplasia	Myelodysplasia	BEFREE	16210092, 16292549, 25611377		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	16210092, 16211386, 16292549, 25611377, 30210693, 30793488		★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	BEFREE	30964202		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	21491416, 23034519, 23975733, 24584817, 25301731, 25611377, 30593524, 30797153		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	21626030, 23034519		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	32824929	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	29910819, 30593524		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	32943033	Associate	★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	23975733		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	9455797		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	24584817		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	30797153		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	20528790		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	35446856	Stimulate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	35681154	Associate	★☆☆☆☆ Found in Text Mining only
Tourette Syndrome	Tourette syndrome	Pubtator	30886340	Associate	★☆☆☆☆ Found in Text Mining only
Triglyceride storage disease with ichthyosis	Triglyceride Storage Disease With Ichthyosis	BEFREE	20528790		★☆☆☆☆ Found in Text Mining only