Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	129807
Gene name	Neuraminidase 4
Gene symbol	NEU4
Synonyms (NCBI Gene)	-
Chromosome	2
Chromosome location	2q37.3
Summary	The protein encoded by this gene belongs to a family of glycohydrolytic enzymes, which remove terminal sialic acid residues from various sialo derivatives, such as glycoproteins, glycolipids, oligosaccharides, and gangliosides. Alternatively spliced trans

Show/Hide all (13)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022484	hsa-miR-124-3p	Microarray	18668037
MIRT1180974	hsa-miR-3177-3p	CLIP-seq
MIRT1180975	hsa-miR-3622b-5p	CLIP-seq
MIRT1180976	hsa-miR-4253	CLIP-seq
MIRT1180977	hsa-miR-4676-5p	CLIP-seq
MIRT1180978	hsa-miR-4688	CLIP-seq
MIRT1180979	hsa-miR-564	CLIP-seq
MIRT1180980	hsa-miR-575	CLIP-seq
MIRT1180981	hsa-miR-3127-3p	CLIP-seq
MIRT1180982	hsa-miR-3667-3p	CLIP-seq
MIRT1180983	hsa-miR-483-3p	CLIP-seq
MIRT2052345	hsa-miR-4263	CLIP-seq
MIRT2052346	hsa-miR-576-5p	CLIP-seq

Show/Hide all (37)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004308	Function	Exo-alpha-sialidase activity	IBA
GO:0004308	Function	Exo-alpha-sialidase activity	IDA	14962670, 15213228, 15847605
GO:0004308	Function	Exo-alpha-sialidase activity	IEA
GO:0004308	Function	Exo-alpha-sialidase activity	TAS
GO:0005515	Function	Protein binding	IPI	16189514, 19060904, 19447967, 21516116, 25416956, 32296183
GO:0005737	Component	Cytoplasm	IBA
GO:0005739	Component	Mitochondrion	IEA
GO:0005741	Component	Mitochondrial outer membrane	IDA	15847605
GO:0005741	Component	Mitochondrial outer membrane	IEA
GO:0005743	Component	Mitochondrial inner membrane	IDA	15847605
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005764	Component	Lysosome	IBA
GO:0005764	Component	Lysosome	IDA	14962670
GO:0005764	Component	Lysosome	IDA	15213228
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IDA	15847605
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0006516	Process	Glycoprotein catabolic process	IDA	15213228, 15847605
GO:0006516	Process	Glycoprotein catabolic process	IEA
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006689	Process	Ganglioside catabolic process	IBA
GO:0006689	Process	Ganglioside catabolic process	IDA	15213228, 15847605
GO:0006689	Process	Ganglioside catabolic process	IEA
GO:0009313	Process	Oligosaccharide catabolic process	IBA
GO:0009313	Process	Oligosaccharide catabolic process	IDA	15213228
GO:0010977	Process	Negative regulation of neuron projection development	IEA
GO:0016020	Component	Membrane	IBA
GO:0016020	Component	Membrane	IEA
GO:0016042	Process	Lipid catabolic process	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0016798	Function	Hydrolase activity, acting on glycosyl bonds	IEA
GO:0019866	Component	Organelle inner membrane	IDA	14962670
GO:0031966	Component	Mitochondrial membrane	IEA
GO:0042995	Component	Cell projection	IEA
GO:0043005	Component	Neuron projection	IEA
GO:0043202	Component	Lysosomal lumen	TAS

MIM	HGNC	e!Ensembl
608527	21328	ENSG00000204099

Q8WWR8

Protein name

Sialidase-4 (EC 3.2.1.18) (N-acetyl-alpha-neuraminidase 4)

Protein function

Exo-alpha-sialidase that catalyzes the hydrolytic cleavage of the terminal sialic acid (N-acetylneuraminic acid, Neu5Ac) of a glycan moiety in the catabolism of glycolipids, glycoproteins and oligosacharides. Efficiently hydrolyzes gangliosides

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13088	BNR_2	34 → 279	BNR repeat-like domain	Domain

Tissue specificity

TISSUE SPECIFICITY: [Isoform 1]: Predominant form in liver. Also expressed in brain, kidney and colon. {ECO:0000269|PubMed:14962670, ECO:0000269|PubMed:15847605}.; TISSUE SPECIFICITY: [Isoform 2]: Highly expressed in brain and at lower levels in kidney an

Sequence

MGVPRTPSRTVLFERERTGLTYRVPSLLPVPPGPTLLAFVEQRLSPDDSHAHRLVLRRGT
LAGGSVRWGALHVLGTAALAEHRSMNPCPVHDAGTGTVFLFFIAVLGHTPEAVQIATGRN
AARLCCVASRDAGLSWGSARDLTEEAIGGAVQDWATFAVGPGHGVQLPSGRLLVPAYTYR
VDRRECFGKICRTSPHSFAFYSDDHGRTWRCGGLVPNLRSGECQLAAVDGGQAGSFLYCN
ARSPLGSRVQALSTDEGTSFLPAERVASLPETAWGCQGSIVGFPAPAPNRPRDDSWSVGP
GSPLQPPLLGPGVHEPPEEAAVDPRGGQVPGGPFSRLQPRGDGPRQPGPRPGVSGDVGSW
TLALPMPFAAPPQSPTWLLYSHPVGRRARLHMGIRLSQSPLDPRSWTEPWVIYEGPSGYS
DLASIGPAPEGGLVFACLYESGARTSYDEISFCTFSLREVLENVPASPKPPNLGDKPRGC
CWPS

Sequence length

484

Interactions

View interactions

	KEGG		Reactome
	Other glycan degradation Sphingolipid metabolism Metabolic pathways		Glycosphingolipid metabolism Sialic acid metabolism

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ATOPIC ECZEMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NARCOLEPSY-CATAPLEXY SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (12)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	17270019, 30700826	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	21521691	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	25144716		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	25144716	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	25144716		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	21521691	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	29278877		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	25144716, 29278877		★★★★★ ★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	30359429		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	25144716		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	25144716	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	37215115	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

NEU4 (neuraminidase 4)