Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	129401
Gene name	Nucleoporin 35
Gene symbol	NUP35
Synonyms (NCBI Gene)	MP-44MP44NP44NUP53
Chromosome	2
Chromosome location	2q32.1
Summary	This gene encodes a member of the nucleoporin family. The encoded protein contains two membrane binding regions, is localized to the nuclear rim, and is part of the nuclear pore complex. All molecules entering or leaving the nucleus either diffuse through

152

Show/Hide all (152)

miRTarBase ID	miRNA	Experiments	Reference
MIRT032327	hsa-let-7b-5p	Proteomics	18668040
MIRT701260	hsa-miR-508-5p	HITS-CLIP	23313552
MIRT701259	hsa-miR-4270	HITS-CLIP	23313552
MIRT701258	hsa-miR-4441	HITS-CLIP	23313552
MIRT701257	hsa-miR-6754-5p	HITS-CLIP	23313552
MIRT701256	hsa-miR-1273g-3p	HITS-CLIP	23313552
MIRT701255	hsa-miR-4712-5p	HITS-CLIP	23313552
MIRT701254	hsa-miR-770-5p	HITS-CLIP	23313552
MIRT701253	hsa-miR-3925-3p	HITS-CLIP	23313552
MIRT701251	hsa-miR-4793-3p	HITS-CLIP	23313552
MIRT701252	hsa-miR-1205	HITS-CLIP	23313552
MIRT701250	hsa-miR-485-5p	HITS-CLIP	23313552
MIRT701249	hsa-miR-6884-5p	HITS-CLIP	23313552
MIRT701248	hsa-miR-6132	HITS-CLIP	23313552
MIRT701247	hsa-miR-6836-5p	HITS-CLIP	23313552
MIRT701246	hsa-miR-1909-3p	HITS-CLIP	23313552
MIRT701245	hsa-miR-6722-3p	HITS-CLIP	23313552
MIRT701244	hsa-miR-505-5p	HITS-CLIP	23313552
MIRT701243	hsa-miR-6827-5p	HITS-CLIP	23313552
MIRT701242	hsa-miR-7703	HITS-CLIP	23313552
MIRT535583	hsa-miR-5007-5p	PAR-CLIP	22012620
MIRT535582	hsa-miR-6508-5p	PAR-CLIP	22012620
MIRT535581	hsa-miR-8067	PAR-CLIP	22012620
MIRT535580	hsa-miR-4477a	PAR-CLIP	22012620
MIRT535579	hsa-miR-6868-3p	PAR-CLIP	22012620
MIRT440071	hsa-miR-106b-5p	HITS-CLIP	22473208
MIRT440072	hsa-miR-20a-5p	HITS-CLIP	22473208
MIRT440071	hsa-miR-106b-5p	HITS-CLIP	22473208
MIRT727055	hsa-miR-17-5p	HITS-CLIP	22473208
MIRT727054	hsa-miR-20b-5p	HITS-CLIP	22473208
MIRT727053	hsa-miR-93-5p	HITS-CLIP	22473208
MIRT727052	hsa-miR-519d-3p	HITS-CLIP	22473208
MIRT440072	hsa-miR-20a-5p	HITS-CLIP	22473208
MIRT701260	hsa-miR-508-5p	HITS-CLIP	23313552
MIRT701259	hsa-miR-4270	HITS-CLIP	23313552
MIRT701258	hsa-miR-4441	HITS-CLIP	23313552
MIRT701257	hsa-miR-6754-5p	HITS-CLIP	23313552
MIRT701256	hsa-miR-1273g-3p	HITS-CLIP	23313552
MIRT701255	hsa-miR-4712-5p	HITS-CLIP	23313552
MIRT701254	hsa-miR-770-5p	HITS-CLIP	23313552
MIRT701253	hsa-miR-3925-3p	HITS-CLIP	23313552
MIRT701251	hsa-miR-4793-3p	HITS-CLIP	23313552
MIRT701252	hsa-miR-1205	HITS-CLIP	23313552
MIRT701250	hsa-miR-485-5p	HITS-CLIP	23313552
MIRT701249	hsa-miR-6884-5p	HITS-CLIP	23313552
MIRT701248	hsa-miR-6132	HITS-CLIP	23313552
MIRT701247	hsa-miR-6836-5p	HITS-CLIP	23313552
MIRT701246	hsa-miR-1909-3p	HITS-CLIP	23313552
MIRT701245	hsa-miR-6722-3p	HITS-CLIP	23313552
MIRT701244	hsa-miR-505-5p	HITS-CLIP	23313552
MIRT701243	hsa-miR-6827-5p	HITS-CLIP	23313552
MIRT701242	hsa-miR-7703	HITS-CLIP	23313552
MIRT535583	hsa-miR-5007-5p	PAR-CLIP	22012620
MIRT535582	hsa-miR-6508-5p	PAR-CLIP	22012620
MIRT535581	hsa-miR-8067	PAR-CLIP	22012620
MIRT535580	hsa-miR-4477a	PAR-CLIP	22012620
MIRT535579	hsa-miR-6868-3p	PAR-CLIP	22012620
MIRT1199304	hsa-miR-106a	CLIP-seq
MIRT1199305	hsa-miR-106b	CLIP-seq
MIRT1199306	hsa-miR-1197	CLIP-seq
MIRT1199307	hsa-miR-1252	CLIP-seq
MIRT1199308	hsa-miR-1283	CLIP-seq
MIRT1199309	hsa-miR-1286	CLIP-seq
MIRT1199310	hsa-miR-15a	CLIP-seq
MIRT1199311	hsa-miR-15b	CLIP-seq
MIRT1199312	hsa-miR-16	CLIP-seq
MIRT1199313	hsa-miR-17	CLIP-seq
MIRT1199314	hsa-miR-195	CLIP-seq
MIRT1199315	hsa-miR-200b	CLIP-seq
MIRT1199316	hsa-miR-200c	CLIP-seq
MIRT1199317	hsa-miR-20a	CLIP-seq
MIRT1199318	hsa-miR-20b	CLIP-seq
MIRT1199319	hsa-miR-217	CLIP-seq
MIRT1199320	hsa-miR-300	CLIP-seq
MIRT1199321	hsa-miR-323b-3p	CLIP-seq
MIRT1199322	hsa-miR-3609	CLIP-seq
MIRT1199323	hsa-miR-3662	CLIP-seq
MIRT1199324	hsa-miR-3664-5p	CLIP-seq
MIRT1199325	hsa-miR-381	CLIP-seq
MIRT1199326	hsa-miR-3914	CLIP-seq
MIRT1199327	hsa-miR-424	CLIP-seq
MIRT1199328	hsa-miR-429	CLIP-seq
MIRT1199329	hsa-miR-4418	CLIP-seq
MIRT1199330	hsa-miR-4436a	CLIP-seq
MIRT1199331	hsa-miR-4504	CLIP-seq
MIRT1199332	hsa-miR-4530	CLIP-seq
MIRT1199333	hsa-miR-4666-3p	CLIP-seq
MIRT1199334	hsa-miR-4677-3p	CLIP-seq
MIRT1199335	hsa-miR-4679	CLIP-seq
MIRT1199336	hsa-miR-4700-3p	CLIP-seq
MIRT1199337	hsa-miR-4722-5p	CLIP-seq
MIRT1199338	hsa-miR-4796-3p	CLIP-seq
MIRT1199339	hsa-miR-497	CLIP-seq
MIRT1199340	hsa-miR-509-3-5p	CLIP-seq
MIRT1199341	hsa-miR-509-5p	CLIP-seq
MIRT1199342	hsa-miR-513c	CLIP-seq
MIRT1199343	hsa-miR-514b-5p	CLIP-seq
MIRT1199344	hsa-miR-519d	CLIP-seq
MIRT1199345	hsa-miR-542-3p	CLIP-seq
MIRT1199346	hsa-miR-548ah	CLIP-seq
MIRT1199347	hsa-miR-634	CLIP-seq
MIRT1199348	hsa-miR-873	CLIP-seq
MIRT1199349	hsa-miR-93	CLIP-seq
MIRT2057783	hsa-miR-197	CLIP-seq
MIRT1199330	hsa-miR-4436a	CLIP-seq
MIRT1199331	hsa-miR-4504	CLIP-seq
MIRT1199334	hsa-miR-4677-3p	CLIP-seq
MIRT1199335	hsa-miR-4679	CLIP-seq
MIRT1199336	hsa-miR-4700-3p	CLIP-seq
MIRT2057784	hsa-miR-4775	CLIP-seq
MIRT1199345	hsa-miR-542-3p	CLIP-seq
MIRT2057785	hsa-miR-935	CLIP-seq
MIRT1199304	hsa-miR-106a	CLIP-seq
MIRT1199305	hsa-miR-106b	CLIP-seq
MIRT1199308	hsa-miR-1283	CLIP-seq
MIRT1199313	hsa-miR-17	CLIP-seq
MIRT1199317	hsa-miR-20a	CLIP-seq
MIRT1199318	hsa-miR-20b	CLIP-seq
MIRT2286126	hsa-miR-338-5p	CLIP-seq
MIRT1199322	hsa-miR-3609	CLIP-seq
MIRT1199324	hsa-miR-3664-5p	CLIP-seq
MIRT2057784	hsa-miR-4775	CLIP-seq
MIRT1199338	hsa-miR-4796-3p	CLIP-seq
MIRT1199342	hsa-miR-513c	CLIP-seq
MIRT1199343	hsa-miR-514b-5p	CLIP-seq
MIRT1199344	hsa-miR-519d	CLIP-seq
MIRT1199346	hsa-miR-548ah	CLIP-seq
MIRT2286127	hsa-miR-618	CLIP-seq
MIRT1199349	hsa-miR-93	CLIP-seq
MIRT2057785	hsa-miR-935	CLIP-seq
MIRT1199309	hsa-miR-1286	CLIP-seq
MIRT1199315	hsa-miR-200b	CLIP-seq
MIRT1199316	hsa-miR-200c	CLIP-seq
MIRT1199319	hsa-miR-217	CLIP-seq
MIRT1199321	hsa-miR-323b-3p	CLIP-seq
MIRT1199328	hsa-miR-429	CLIP-seq
MIRT1199329	hsa-miR-4418	CLIP-seq
MIRT1199337	hsa-miR-4722-5p	CLIP-seq
MIRT1199340	hsa-miR-509-3-5p	CLIP-seq
MIRT1199341	hsa-miR-509-5p	CLIP-seq
MIRT1199348	hsa-miR-873	CLIP-seq
MIRT2584030	hsa-miR-1290	CLIP-seq
MIRT1199323	hsa-miR-3662	CLIP-seq
MIRT2584031	hsa-miR-4668-3p	CLIP-seq
MIRT2584032	hsa-miR-4699-3p	CLIP-seq
MIRT2057784	hsa-miR-4775	CLIP-seq
MIRT2584033	hsa-miR-5095	CLIP-seq
MIRT2057785	hsa-miR-935	CLIP-seq
MIRT2584030	hsa-miR-1290	CLIP-seq
MIRT2584031	hsa-miR-4668-3p	CLIP-seq
MIRT2584032	hsa-miR-4699-3p	CLIP-seq
MIRT2584033	hsa-miR-5095	CLIP-seq

Show/Hide all (26)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003676	Function	Nucleic acid binding	IEA
GO:0005515	Function	Protein binding	IPI	25416956, 28514442, 32296183, 33961781
GO:0005543	Function	Phospholipid binding	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005635	Component	Nuclear envelope	IDA	24315095
GO:0005635	Component	Nuclear envelope	TAS
GO:0005643	Component	Nuclear pore	IEA
GO:0005643	Component	Nuclear pore	NAS	24315095
GO:0005654	Component	Nucleoplasm	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IDA
GO:0006607	Process	NLS-bearing protein import into nucleus	IBA
GO:0006913	Process	Nucleocytoplasmic transport	IEA
GO:0006913	Process	Nucleocytoplasmic transport	NAS	27016207
GO:0006999	Process	Nuclear pore organization	IBA
GO:0015031	Process	Protein transport	IEA
GO:0016020	Component	Membrane	IEA
GO:0017056	Function	Structural constituent of nuclear pore	IBA
GO:0017056	Function	Structural constituent of nuclear pore	IEA
GO:0031965	Component	Nuclear membrane	IDA
GO:0031965	Component	Nuclear membrane	IEA
GO:0042802	Function	Identical protein binding	IEA
GO:0044613	Component	Nuclear pore central transport channel	IBA
GO:0044615	Component	Nuclear pore nuclear basket	IBA
GO:0051028	Process	MRNA transport	IEA
GO:1990830	Process	Cellular response to leukemia inhibitory factor	IEA

MIM	HGNC	e!Ensembl
608140	29797	ENSG00000163002

Q8NFH5

Protein name

Nucleoporin NUP35 (35 kDa nucleoporin) (Mitotic phosphoprotein 44) (MP-44) (Nuclear pore complex protein Nup53) (Nucleoporin NUP53)

Protein function

Functions as a component of the nuclear pore complex (NPC). NPC components, collectively referred to as nucleoporins (NUPs), can play the role of both NPC structural components and of docking or interaction partners for transiently associated nu

PDB

4LIR , 7MW1 , 7R5J , 7R5K , 8OZB

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF05172	Nup35_RRM	167 → 252	Nup53/35/40-type RNA recognition motif	Domain

Sequence

MAAFAVEPQGPALGSEPMMLGSPTSPKPGVNAQFLPGFLMGDLPAPVTPQPRSISGPSVG
VMEMRSPLLAGGSPPQPVVPAHKDKSGAPPVRSIYDDISSPGLGSTPLTSRRQPNISVMQ
SPLVGVTSTPGTGQSMFSPASIGQPRKTTLSPAQLDPFYTQGDSLTSEDHLDDSWVTVFG
FPQASASYILLQFAQYGNILKHVMSNTGNWMHIRYQSKLQARKALSKDGRIFGESIMIGV
KPCIDKSVMESSDRCALSSPSLAFTPPIKTLGTPTQPGSTPRISTMRPLATAYKASTSDY
QVISDRQTPKKDESLVSKAMEYMFGW

Sequence length

326

Interactions

View interactions

	KEGG		Reactome
	Nucleocytoplasmic transport Amyotrophic lateral sclerosis		ISG15 antiviral mechanism Transport of the SLBP independent Mature mRNA Transport of the SLBP Dependant Mature mRNA Transport of Mature mRNA Derived from an Intronless Transcript Transport of Mature mRNA derived from an Intron-Containing Transcript Rev-mediated nuclear export of HIV RNA Transport of Ribonucleoproteins into the Host Nucleus NS1 Mediated Effects on Host Pathways Viral Messenger RNA Synthesis NEP/NS2 Interacts with the Cellular Export Machinery Regulation of Glucokinase by Glucokinase Regulatory Protein Vpr-mediated nuclear import of PICs snRNP Assembly SUMOylation of DNA damage response and repair proteins SUMOylation of ubiquitinylation proteins Nuclear Pore Complex (NPC) Disassembly Regulation of HSF1-mediated heat shock response SUMOylation of SUMOylation proteins SUMOylation of chromatin organization proteins SUMOylation of RNA binding proteins SUMOylation of DNA replication proteins Transcriptional regulation by small RNAs Defective TPR may confer susceptibility towards thyroid papillary carcinoma (TPC) tRNA processing in the nucleus HCMV Early Events HCMV Late Events Postmitotic nuclear pore complex (NPC) reformation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
SCOLIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (2)

Disease Name	Disease (Merged)	Source	PMID	Evidence Score
Associations from Text Mining Disease associations identified through text mining
AICARDI-GOUTIERES SYNDROME	Aicardi Goutieres Syndrome	BEFREE	26585375	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	26585375	★★★★★ ★☆☆☆☆ Found in Text Mining only

NUP35 (nucleoporin 35)