Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	128414
Gene name	Sodium/potassium transporting ATPase interacting 4
Gene symbol	NKAIN4
Synonyms (NCBI Gene)	C20orf58FAM77AbA261N11.2
Chromosome	20
Chromosome location	20q13.33
Summary	NKAIN4 is a member of a family of mammalian proteins (see NKAIN1; MIM 612871) with similarity to Drosophila Nkain and interacts with the beta subunit of Na,K-ATPase (ATP1B1; MIM 182330) (Gorokhova et al., 2007 [PubMed 17606467]).[supplied by OMIM, Jun 200

Show/Hide all (50)

miRTarBase ID	miRNA	Experiments
MIRT1186061	hsa-miR-1278	CLIP-seq
MIRT1186062	hsa-miR-197	CLIP-seq
MIRT1186063	hsa-miR-3192	CLIP-seq
MIRT1186064	hsa-miR-3922-5p	CLIP-seq
MIRT1186065	hsa-miR-4300	CLIP-seq
MIRT1186066	hsa-miR-4763-5p	CLIP-seq
MIRT1186067	hsa-miR-661	CLIP-seq
MIRT1186068	hsa-miR-920	CLIP-seq
MIRT2053934	hsa-miR-2467-5p	CLIP-seq
MIRT2053935	hsa-miR-3135b	CLIP-seq
MIRT2053936	hsa-miR-3188	CLIP-seq
MIRT2053937	hsa-miR-3612	CLIP-seq
MIRT2053938	hsa-miR-3652	CLIP-seq
MIRT2053939	hsa-miR-3975	CLIP-seq
MIRT2053940	hsa-miR-4430	CLIP-seq
MIRT2053941	hsa-miR-4443	CLIP-seq
MIRT2053942	hsa-miR-4649-3p	CLIP-seq
MIRT2053943	hsa-miR-4717-5p	CLIP-seq
MIRT2053944	hsa-miR-485-5p	CLIP-seq
MIRT2053945	hsa-miR-650	CLIP-seq
MIRT2283113	hsa-miR-1915	CLIP-seq
MIRT2053934	hsa-miR-2467-5p	CLIP-seq
MIRT2053935	hsa-miR-3135b	CLIP-seq
MIRT2053936	hsa-miR-3188	CLIP-seq
MIRT2053937	hsa-miR-3612	CLIP-seq
MIRT2053938	hsa-miR-3652	CLIP-seq
MIRT2283114	hsa-miR-3665	CLIP-seq
MIRT2053939	hsa-miR-3975	CLIP-seq
MIRT2053940	hsa-miR-4430	CLIP-seq
MIRT2283115	hsa-miR-4436b-3p	CLIP-seq
MIRT2053941	hsa-miR-4443	CLIP-seq
MIRT2053942	hsa-miR-4649-3p	CLIP-seq
MIRT2283116	hsa-miR-4685-5p	CLIP-seq
MIRT2053943	hsa-miR-4717-5p	CLIP-seq
MIRT2283117	hsa-miR-4736	CLIP-seq
MIRT2053944	hsa-miR-485-5p	CLIP-seq
MIRT2053945	hsa-miR-650	CLIP-seq
MIRT2283118	hsa-miR-764	CLIP-seq
MIRT2581368	hsa-miR-1301	CLIP-seq
MIRT2581369	hsa-miR-4327	CLIP-seq
MIRT2581370	hsa-miR-4519	CLIP-seq
MIRT2581371	hsa-miR-5047	CLIP-seq
MIRT2581372	hsa-miR-520f	CLIP-seq
MIRT2581373	hsa-miR-636	CLIP-seq
MIRT2581368	hsa-miR-1301	CLIP-seq
MIRT2581369	hsa-miR-4327	CLIP-seq
MIRT2581370	hsa-miR-4519	CLIP-seq
MIRT2581371	hsa-miR-5047	CLIP-seq
MIRT2581372	hsa-miR-520f	CLIP-seq
MIRT2581373	hsa-miR-636	CLIP-seq

Show/Hide all (4)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002028	Process	Regulation of sodium ion transport	IBA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005886	Component	Plasma membrane	IEA
GO:0016020	Component	Membrane	IEA

MIM	HGNC	e!Ensembl
612873	16191	ENSG00000101198

Q8IVV8

Protein name

Sodium/potassium-transporting ATPase subunit beta-1-interacting protein 4 (Na(+)/K(+)-transporting ATPase subunit beta-1-interacting protein 4) (Protein FAM77A)

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF05640	NKAIN	1 → 207	Na,K-Atpase Interacting protein	Family

Sequence

MGSCSGRCALVVLCAFQLVAALERQVFDFLGYQWAPILANFVHIIIVILGLFGTIQYRLR
YVMVYTLWAAVWVTWNVFIICFYLEVGGLLKDSELLTFSLSRHRSWWRERWPGCLHEEVP
AVGLGAPHGQALVSGAGCALEPSYVEALHSCLQILIALLGFVCGCQVVSVFTEEEDSFDF
IGGFDPFPLYHVNEKPSSLLSKQVYLPA

Sequence length

208

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CARDIOVASCULAR DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (3)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Cardiovascular Diseases	Cardiovascular Diseases	GWASCAT_DG	21779381		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	33028275	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	37466093	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

NKAIN4 (sodium/potassium transporting ATPase interacting 4)