Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	128239
Gene name	IQ motif containing GTPase activating protein 3
Gene symbol	IQGAP3
Synonyms (NCBI Gene)	-
Chromosome	1
Chromosome location	1q22

Show/Hide all (1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs1571320137	A>T	Likely-pathogenic	Intron variant

Show/Hide all (53)

miRTarBase ID	miRNA	Experiments	Reference
MIRT001363	hsa-miR-1-3p	pSILAC	18668040
MIRT001363	hsa-miR-1-3p	Proteomics;Other	18668040
MIRT1070068	hsa-miR-128	CLIP-seq
MIRT1070069	hsa-miR-140-3p	CLIP-seq
MIRT1070070	hsa-miR-3591-5p	CLIP-seq
MIRT1070071	hsa-miR-4424	CLIP-seq
MIRT1070072	hsa-miR-4710	CLIP-seq
MIRT1070073	hsa-miR-4792	CLIP-seq
MIRT2017198	hsa-miR-3925-5p	CLIP-seq
MIRT2017199	hsa-miR-4632	CLIP-seq
MIRT2017200	hsa-miR-4641	CLIP-seq
MIRT2017201	hsa-miR-4709-5p	CLIP-seq
MIRT2017202	hsa-miR-520a-5p	CLIP-seq
MIRT2017203	hsa-miR-525-5p	CLIP-seq
MIRT2017204	hsa-miR-640	CLIP-seq
MIRT2017205	hsa-miR-759	CLIP-seq
MIRT2249140	hsa-miR-1225-5p	CLIP-seq
MIRT2249141	hsa-miR-127-5p	CLIP-seq
MIRT2249142	hsa-miR-186	CLIP-seq
MIRT2249143	hsa-miR-2392	CLIP-seq
MIRT2249144	hsa-miR-2467-3p	CLIP-seq
MIRT2249145	hsa-miR-29a	CLIP-seq
MIRT2249146	hsa-miR-29b	CLIP-seq
MIRT2249147	hsa-miR-29c	CLIP-seq
MIRT2249148	hsa-miR-3132	CLIP-seq
MIRT2249149	hsa-miR-3184	CLIP-seq
MIRT2249150	hsa-miR-34a	CLIP-seq
MIRT2249151	hsa-miR-34c-5p	CLIP-seq
MIRT2017198	hsa-miR-3925-5p	CLIP-seq
MIRT2249152	hsa-miR-423-5p	CLIP-seq
MIRT2249153	hsa-miR-4259	CLIP-seq
MIRT2249154	hsa-miR-4422	CLIP-seq
MIRT2249155	hsa-miR-449a	CLIP-seq
MIRT2249156	hsa-miR-449b	CLIP-seq
MIRT2249157	hsa-miR-4635	CLIP-seq
MIRT2249158	hsa-miR-4726-3p	CLIP-seq
MIRT2249159	hsa-miR-4731-5p	CLIP-seq
MIRT2249160	hsa-miR-486-3p	CLIP-seq
MIRT2017202	hsa-miR-520a-5p	CLIP-seq
MIRT2249161	hsa-miR-520f	CLIP-seq
MIRT2017203	hsa-miR-525-5p	CLIP-seq
MIRT2249162	hsa-miR-636	CLIP-seq
MIRT2017204	hsa-miR-640	CLIP-seq
MIRT2017205	hsa-miR-759	CLIP-seq
MIRT2249163	hsa-miR-940	CLIP-seq
MIRT2249149	hsa-miR-3184	CLIP-seq
MIRT2249152	hsa-miR-423-5p	CLIP-seq
MIRT2017202	hsa-miR-520a-5p	CLIP-seq
MIRT2017203	hsa-miR-525-5p	CLIP-seq
MIRT2249149	hsa-miR-3184	CLIP-seq
MIRT2249152	hsa-miR-423-5p	CLIP-seq
MIRT2017202	hsa-miR-520a-5p	CLIP-seq
MIRT2017203	hsa-miR-525-5p	CLIP-seq

Show/Hide all (24)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000082	Process	G1/S transition of mitotic cell cycle	IEA
GO:0005096	Function	GTPase activator activity	IBA
GO:0005515	Function	Protein binding	IPI	32814053
GO:0005516	Function	Calmodulin binding	IBA
GO:0005516	Function	Calmodulin binding	IEA
GO:0005516	Function	Calmodulin binding	IPI	21299499
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005911	Component	Cell-cell junction	IEA
GO:0005938	Component	Cell cortex	IBA
GO:0007265	Process	Ras protein signal transduction	IEA
GO:0008361	Process	Regulation of cell size	IEA
GO:0010467	Process	Gene expression	IEA
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0010629	Process	Negative regulation of gene expression	IEA
GO:0016328	Component	Lateral plasma membrane	IEA
GO:0031267	Function	Small GTPase binding	IEA
GO:0033598	Process	Mammary gland epithelial cell proliferation	IEA
GO:0033601	Process	Positive regulation of mammary gland epithelial cell proliferation	IEA
GO:0043410	Process	Positive regulation of MAPK cascade	IEA
GO:0051015	Function	Actin filament binding	IBA
GO:0070371	Process	ERK1 and ERK2 cascade	IEA
GO:0070856	Function	Myosin VI light chain binding	IPI	21299499
GO:1903479	Process	Mitotic actomyosin contractile ring assembly actin filament organization	IBA

MIM	HGNC	e!Ensembl
621092	20669	ENSG00000183856

Q86VI3

Protein name

Ras GTPase-activating-like protein IQGAP3

PDB

3ISU

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00307	CH	34 → 150	Calponin homology (CH) domain	Domain
PF00612	IQ	733 → 751	IQ calmodulin-binding motif	Motif
PF00612	IQ	761 → 781	IQ calmodulin-binding motif	Motif
PF00612	IQ	791 → 811	IQ calmodulin-binding motif	Motif
PF00612	IQ	821 → 841	IQ calmodulin-binding motif	Motif
PF00616	RasGAP	1009 → 1221	GTPase-activator protein for Ras-like GTPase	Family
PF03836	RasGAP_C	1433 → 1554	RasGAP C-terminus	Family

Sequence

MERRAAGPGWAAYERLTAEEMDEQRRQNVAYQYLCRLEEAKRWMEACLKEELPSPVELEE
SLRNGVLLAKLGHCFAPSVVPLKKIYDVEQLRYQATGLHFRHTDNINFWLSAIAHIGLPS
TFFPETTDIYDKKNMPRVVYCIHALSLFLFRLGLAPQIHDLYGKVKFTAEELSNMASELA
KYGLQLPAFSKIGGILANELSVDEAAVHAAVLAINEAVERGVVEDTLAALQNPSALLENL
REPLAAVYQEMLAQAKMEKAANARNHDDRESQDIYDHYLTQAEIQGNINHVNVHGALEVV
DDALERQSPEALLKALQDPALALRGVRRDFADWYLEQLNSDREQKAQELGLVELLEKEEV
QAGVAAANTKGDQEQAMLHAVQRINKAIRRRVAADTVKELMCPEAQLPPVYPVASSMYQL
ELAVLQQQQGELGQEELFVAVEMLSAVVLINRALEARDASGFWSSLVNPATGLAEVEGEN
AQRYFDALLKLRQERGMGEDFLSWNDLQATVSQVNAQTQEETDRVLAVSLINEALDKGSP
EKTLSALLLPAAGLDDVSLPVAPRYHLLLVAAKRQKAQVTGDPGAVLWLEEIRQGVVRAN
QDTNTAQRMALGVAAINQAIKEGKAAQTERVLRNPAVALRGVVPDCANGYQRALESAMAK
KQRPADTAFWVQHDMKDGTAYYFHLQTFQGIWEQPPGCPLNTSHLTREEIQSAVTKVTAA
YDRQQLWKANVGFVIQLQARLRGFLVRQKFAEHSHFLRTWLPAVIKIQAHWRGYRQRKIY
LEWLQYFKANLDAIIKIQAWARMWAARRQYLRRLHYFQKNVNSIVKIQAFFRARKAQDDY
RILVHAPHPPLSVVRRFAHLLNQSQQDFLAEAELLKLQEEVVRKIRSNQQLEQDLNIMDI
KIGLLVKNRITLQEVVSHCKKLTKRNKEQLSDMMVLDKQKGLKSLSKEKRQKLEAYQHLF
YLLQTQPIYLAKLIFQMPQNKTTKFMEAVIFSLYNYASSRREAYLLLQLFKTALQEEIKS
KVEQPQDVVTGNPTVVRLVVRFYRNGRGQSALQEILGKVIQDVLEDKVLSVHTDPVHLYK
NWINQTEAQTGQRSHLPYDVTPEQALSHPEVQRRLDIALRNLLAMTDKFLLAITSSVDQI
PYGMRYVAKVLKATLAEKFPDATDSEVYKVVGNLLYYRFLNPAVVAPDAFDIVAMAAGGA
LAAPQRHALGAVAQLLQHAAAGKAFSGQSQHLRVLNDYLEETHLKFRKFIHRACQVPEPE
ERFAVDEYSDMVAVAKPMVYITVGELVNTHRLLLEHQDCIAPDHQDPLHELLEDLGELPT
IPDLIGESIAADGHTDLSKLEVSLTLTNKFEGLEADADDSNTRSLLLSTKQLLADIIQFH
PGDTLKEILSLSASREQEAAHKQLMSRRQACTAQTPEPLRRHRSLTAHSLLPLAEKQRRV
LRNLRRLEALGLVSARNGYQGLVDELAKDIRNQHRHRHRRKAELVKLQATLQGLSTKTTF
YEEQGDYYSQYIRACLDHLAPDSKSSGKGKKQPSLHYTAAQLLEKGVLVEIEDLPASHFR
NVIFDITPGDEAGKFEVNAKFLGVDMERFQLHYQDLLQLQYEGVAVMKLFNKAKVNVNLL
IFLLNKKFLRK

Sequence length

1631

Interactions

View interactions

	KEGG		Reactome
	Regulation of actin cytoskeleton		RHO GTPases activate IQGAPs

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Motor and sensory neuropathy	Likely pathogenic	rs1571320137	RCV000856566	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (22)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Acute myeloid leukemia	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Adrenocortical carcinoma, hereditary	Likely benign; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial pancreatic carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Likely benign; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IQGAP3-related disorder	Uncertain significance; Likely benign; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (30)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Autism Spectrum Disorders	Autism Spectrum Disorder	CTD_human_DG	28191889		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	31605603		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	29581849, 30446454, 31088707		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	28281966, 31605603		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	28281966, 31605603	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	25848980, 30696738, 36275458	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	18277965, 35030478, 36524514	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	36320006	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	29581849, 30446454, 31088707		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	24849319		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	35355828	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	36275458	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	31223291, 31544570		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	31544570	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	28284560		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	28810875, 30906629		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	28810875		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	24849319	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	31544570	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	28281966, 31605603		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	24849319		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	29131081		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	29581849, 30446454, 31088707		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	24849319, 25848980, 28810875, 29073199		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	24849319, 29581849		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	35355828, 36164370	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	29131081		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	37724892	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	35993042	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	37042849	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

IQGAP3 (IQ motif containing GTPase activating protein 3)