Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Entrez ID	128209
Gene name	KLF transcription factor 17
Gene symbol	KLF17
Synonyms (NCBI Gene)	ZLF393ZNF393Zfp393
Chromosome	1
Chromosome location	1p34.1

187

Show/Hide all (187)

miRTarBase ID	miRNA	Experiments	Reference
MIRT053212	hsa-miR-9-5p	Luciferase reporter assayWestern blot	23684102
MIRT540121	hsa-miR-5588-3p	PAR-CLIP	21572407
MIRT540120	hsa-miR-2114-5p	PAR-CLIP	21572407
MIRT540119	hsa-miR-1228-3p	PAR-CLIP	21572407
MIRT540118	hsa-miR-383-3p	PAR-CLIP	21572407
MIRT540117	hsa-miR-342-3p	PAR-CLIP	21572407
MIRT540116	hsa-miR-4284	PAR-CLIP	21572407
MIRT540115	hsa-miR-24-3p	PAR-CLIP	21572407
MIRT540114	hsa-miR-7977	PAR-CLIP	21572407
MIRT540113	hsa-miR-450a-1-3p	PAR-CLIP	21572407
MIRT540112	hsa-miR-3122	PAR-CLIP	21572407
MIRT540111	hsa-miR-3913-5p	PAR-CLIP	21572407
MIRT540110	hsa-miR-887-5p	PAR-CLIP	21572407
MIRT540109	hsa-miR-6513-5p	PAR-CLIP	21572407
MIRT445773	hsa-miR-3668	PAR-CLIP	22100165
MIRT445771	hsa-miR-4635	PAR-CLIP	22100165
MIRT445772	hsa-miR-4709-3p	PAR-CLIP	22100165
MIRT540121	hsa-miR-5588-3p	PAR-CLIP	21572407
MIRT540120	hsa-miR-2114-5p	PAR-CLIP	21572407
MIRT540119	hsa-miR-1228-3p	PAR-CLIP	21572407
MIRT540118	hsa-miR-383-3p	PAR-CLIP	21572407
MIRT540117	hsa-miR-342-3p	PAR-CLIP	21572407
MIRT540116	hsa-miR-4284	PAR-CLIP	21572407
MIRT540115	hsa-miR-24-3p	PAR-CLIP	21572407
MIRT540114	hsa-miR-7977	PAR-CLIP	21572407
MIRT540113	hsa-miR-450a-1-3p	PAR-CLIP	21572407
MIRT540112	hsa-miR-3122	PAR-CLIP	21572407
MIRT540111	hsa-miR-3913-5p	PAR-CLIP	21572407
MIRT540110	hsa-miR-887-5p	PAR-CLIP	21572407
MIRT540109	hsa-miR-6513-5p	PAR-CLIP	21572407
MIRT445773	hsa-miR-3668	PAR-CLIP	22100165
MIRT445771	hsa-miR-4635	PAR-CLIP	22100165
MIRT445772	hsa-miR-4709-3p	PAR-CLIP	22100165
MIRT1096259	hsa-miR-122	CLIP-seq
MIRT1096260	hsa-miR-1236	CLIP-seq
MIRT1096261	hsa-miR-1237	CLIP-seq
MIRT1096262	hsa-miR-1248	CLIP-seq
MIRT1096263	hsa-miR-1254	CLIP-seq
MIRT1096264	hsa-miR-1273f	CLIP-seq
MIRT1096265	hsa-miR-1285	CLIP-seq
MIRT1096266	hsa-miR-129-5p	CLIP-seq
MIRT1096267	hsa-miR-130a	CLIP-seq
MIRT1096268	hsa-miR-130b	CLIP-seq
MIRT1096269	hsa-miR-1538	CLIP-seq
MIRT1096270	hsa-miR-1587	CLIP-seq
MIRT1096271	hsa-miR-197	CLIP-seq
MIRT1096272	hsa-miR-2110	CLIP-seq
MIRT1096273	hsa-miR-2355-5p	CLIP-seq
MIRT1096274	hsa-miR-301a	CLIP-seq
MIRT1096275	hsa-miR-301b	CLIP-seq
MIRT1096276	hsa-miR-3116	CLIP-seq
MIRT1096277	hsa-miR-3135b	CLIP-seq
MIRT1096278	hsa-miR-3146	CLIP-seq
MIRT1096279	hsa-miR-3149	CLIP-seq
MIRT1096280	hsa-miR-3159	CLIP-seq
MIRT1096281	hsa-miR-3170	CLIP-seq
MIRT1096282	hsa-miR-3187-5p	CLIP-seq
MIRT1096283	hsa-miR-328	CLIP-seq
MIRT1096284	hsa-miR-3652	CLIP-seq
MIRT1096285	hsa-miR-3663-5p	CLIP-seq
MIRT1096286	hsa-miR-3666	CLIP-seq
MIRT1096287	hsa-miR-3674	CLIP-seq
MIRT1096288	hsa-miR-4264	CLIP-seq
MIRT1096289	hsa-miR-4271	CLIP-seq
MIRT1096290	hsa-miR-4283	CLIP-seq
MIRT1096291	hsa-miR-4295	CLIP-seq
MIRT1096292	hsa-miR-4417	CLIP-seq
MIRT1096293	hsa-miR-4430	CLIP-seq
MIRT1096294	hsa-miR-4489	CLIP-seq
MIRT1096295	hsa-miR-4492	CLIP-seq
MIRT1096296	hsa-miR-4498	CLIP-seq
MIRT1096297	hsa-miR-4505	CLIP-seq
MIRT1096298	hsa-miR-454	CLIP-seq
MIRT1096299	hsa-miR-4650-5p	CLIP-seq
MIRT1096300	hsa-miR-4656	CLIP-seq
MIRT1096301	hsa-miR-4667-5p	CLIP-seq
MIRT1096302	hsa-miR-4675	CLIP-seq
MIRT1096303	hsa-miR-4690-5p	CLIP-seq
MIRT1096304	hsa-miR-4700-5p	CLIP-seq
MIRT1096305	hsa-miR-4710	CLIP-seq
MIRT1096306	hsa-miR-4716-5p	CLIP-seq
MIRT1096307	hsa-miR-4725-3p	CLIP-seq
MIRT1096308	hsa-miR-4731-5p	CLIP-seq
MIRT1096309	hsa-miR-4732-5p	CLIP-seq
MIRT1096310	hsa-miR-4740-3p	CLIP-seq
MIRT1096311	hsa-miR-4741	CLIP-seq
MIRT1096312	hsa-miR-4745-3p	CLIP-seq
MIRT1096313	hsa-miR-4753-3p	CLIP-seq
MIRT1096314	hsa-miR-4757-5p	CLIP-seq
MIRT1096315	hsa-miR-4778-3p	CLIP-seq
MIRT1096316	hsa-miR-4781-3p	CLIP-seq
MIRT1096317	hsa-miR-4792	CLIP-seq
MIRT1096318	hsa-miR-4795-3p	CLIP-seq
MIRT1096319	hsa-miR-5096	CLIP-seq
MIRT1096320	hsa-miR-541	CLIP-seq
MIRT1096321	hsa-miR-612	CLIP-seq
MIRT1096322	hsa-miR-622	CLIP-seq
MIRT1096323	hsa-miR-654-5p	CLIP-seq
MIRT1096324	hsa-miR-720	CLIP-seq
MIRT1096325	hsa-miR-762	CLIP-seq
MIRT1096326	hsa-miR-885-3p	CLIP-seq
MIRT1096327	hsa-miR-942	CLIP-seq
MIRT2026017	hsa-miR-1207-5p	CLIP-seq
MIRT1096264	hsa-miR-1273f	CLIP-seq
MIRT1096269	hsa-miR-1538	CLIP-seq
MIRT2026018	hsa-miR-1909	CLIP-seq
MIRT1096271	hsa-miR-197	CLIP-seq
MIRT2026019	hsa-miR-3152-3p	CLIP-seq
MIRT1096281	hsa-miR-3170	CLIP-seq
MIRT2026020	hsa-miR-3182	CLIP-seq
MIRT1096283	hsa-miR-328	CLIP-seq
MIRT1096285	hsa-miR-3663-5p	CLIP-seq
MIRT2026021	hsa-miR-4268	CLIP-seq
MIRT2026022	hsa-miR-4269	CLIP-seq
MIRT2026023	hsa-miR-4436b-3p	CLIP-seq
MIRT2026024	hsa-miR-4448	CLIP-seq
MIRT2026025	hsa-miR-4659a-3p	CLIP-seq
MIRT2026026	hsa-miR-4659b-3p	CLIP-seq
MIRT2026027	hsa-miR-4688	CLIP-seq
MIRT1096306	hsa-miR-4716-5p	CLIP-seq
MIRT1096312	hsa-miR-4745-3p	CLIP-seq
MIRT2026028	hsa-miR-4763-3p	CLIP-seq
MIRT2026029	hsa-miR-4764-3p	CLIP-seq
MIRT1096315	hsa-miR-4778-3p	CLIP-seq
MIRT1096316	hsa-miR-4781-3p	CLIP-seq
MIRT2026030	hsa-miR-486-3p	CLIP-seq
MIRT1096319	hsa-miR-5096	CLIP-seq
MIRT2026017	hsa-miR-1207-5p	CLIP-seq
MIRT1096259	hsa-miR-122	CLIP-seq
MIRT1096265	hsa-miR-1285	CLIP-seq
MIRT1096267	hsa-miR-130a	CLIP-seq
MIRT1096268	hsa-miR-130b	CLIP-seq
MIRT2257036	hsa-miR-181a	CLIP-seq
MIRT2257037	hsa-miR-181b	CLIP-seq
MIRT2257038	hsa-miR-181c	CLIP-seq
MIRT2257039	hsa-miR-181d	CLIP-seq
MIRT2026018	hsa-miR-1909	CLIP-seq
MIRT1096274	hsa-miR-301a	CLIP-seq
MIRT1096275	hsa-miR-301b	CLIP-seq
MIRT1096277	hsa-miR-3135b	CLIP-seq
MIRT1096282	hsa-miR-3187-5p	CLIP-seq
MIRT2257040	hsa-miR-3200-5p	CLIP-seq
MIRT1096284	hsa-miR-3652	CLIP-seq
MIRT1096285	hsa-miR-3663-5p	CLIP-seq
MIRT1096286	hsa-miR-3666	CLIP-seq
MIRT2257041	hsa-miR-3670	CLIP-seq
MIRT2257042	hsa-miR-3974	CLIP-seq
MIRT2257043	hsa-miR-4262	CLIP-seq
MIRT2026022	hsa-miR-4269	CLIP-seq
MIRT1096291	hsa-miR-4295	CLIP-seq
MIRT2257044	hsa-miR-4303	CLIP-seq
MIRT1096293	hsa-miR-4430	CLIP-seq
MIRT1096298	hsa-miR-454	CLIP-seq
MIRT2026027	hsa-miR-4688	CLIP-seq
MIRT1096305	hsa-miR-4710	CLIP-seq
MIRT1096306	hsa-miR-4716-5p	CLIP-seq
MIRT2026028	hsa-miR-4763-3p	CLIP-seq
MIRT2257045	hsa-miR-4772-3p	CLIP-seq
MIRT1096317	hsa-miR-4792	CLIP-seq
MIRT2026030	hsa-miR-486-3p	CLIP-seq
MIRT1096321	hsa-miR-612	CLIP-seq
MIRT2452631	hsa-miR-3151	CLIP-seq
MIRT1096290	hsa-miR-4283	CLIP-seq
MIRT2452632	hsa-miR-4447	CLIP-seq
MIRT2452633	hsa-miR-4472	CLIP-seq
MIRT1096294	hsa-miR-4489	CLIP-seq
MIRT2452634	hsa-miR-491-5p	CLIP-seq
MIRT2452631	hsa-miR-3151	CLIP-seq
MIRT1096290	hsa-miR-4283	CLIP-seq
MIRT2452632	hsa-miR-4447	CLIP-seq
MIRT2452633	hsa-miR-4472	CLIP-seq
MIRT1096294	hsa-miR-4489	CLIP-seq
MIRT2452634	hsa-miR-491-5p	CLIP-seq
MIRT1096260	hsa-miR-1236	CLIP-seq
MIRT2558470	hsa-miR-2467-3p	CLIP-seq
MIRT2558471	hsa-miR-3158-5p	CLIP-seq
MIRT2558472	hsa-miR-3678-3p	CLIP-seq
MIRT2558473	hsa-miR-4751	CLIP-seq
MIRT1096313	hsa-miR-4753-3p	CLIP-seq
MIRT2558474	hsa-miR-596	CLIP-seq
MIRT1096327	hsa-miR-942	CLIP-seq
MIRT2452631	hsa-miR-3151	CLIP-seq
MIRT1096290	hsa-miR-4283	CLIP-seq
MIRT2452632	hsa-miR-4447	CLIP-seq
MIRT2452633	hsa-miR-4472	CLIP-seq
MIRT1096294	hsa-miR-4489	CLIP-seq
MIRT2452634	hsa-miR-491-5p	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
TWIST1	Unknown	24220291

Show/Hide all (15)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000976	Function	Transcription cis-regulatory region binding	ISS
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	ISS
GO:0005515	Function	Protein binding	IPI	25416956, 32296183
GO:0005634	Component	Nucleus	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	ISS
GO:0008270	Function	Zinc ion binding	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IEA

MIM	HGNC	e!Ensembl
609602	18830	ENSG00000171872

Q5JT82

Protein name

Krueppel-like factor 17 (Zinc finger protein 393)

Protein function

Transcription repressor that binds to the promoter of target genes and prevents their expression. Acts as a negative regulator of epithelial-mesenchymal transition and metastasis in breast cancer. Specifically binds the 5'-CACCC-3' sequence in t

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00096	zf-C2H2	283 → 307	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	313 → 337	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	343 → 365	Zinc finger, C2H2 type	Domain

Sequence

MYGRPQAEMEQEAGELSRWQAAHQAAQDNENSAPILNMSSSSGSSGVHTSWNQGLPSIQH
FPHSAEMLGSPLVSVEAPGQNVNEGGPQFSMPLPERGMSYCPQATLTPSRMIYCQRMSPP
QQEMTIFSGPQLMPVGEPNIPRVARPFGGNLRMPPNGLPVSASTGIPIMSHTGNPPVPYP
GLSTVPSDETLLGPTVPSTEAQAVLPSMAQMLPPQDAHDLGMPPAESQSLLVLGSQDSLV
SQPDSQEGPFLPEQPGPAPQTVEKNSRPQEGTGRRGSSEARPYCCNYENCGKAYTKRSHL
VSHQRKHTGERPYSCNWESCSWSFFRSDELRRHMRVHTRYRPYKCDQCSREFMRSDHLKQ
HQKTHRPGPSDPQANNNNGEQDSPPAAGP

Sequence length

389

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CORNEAL NEOVASCULARIZATION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EBV-positive nodal T- and NK-cell lymphoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KERATITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (31)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	28454121		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	19801974, 24504364, 27107895, 28744404, 29701902, 30524945		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	24504364	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	23684102, 25766320	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	25911104, 28454121		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	39215019	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chordoma	Chordoma	Pubtator	31994243	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	28423541, 31545467		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	28423541	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	26617836		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	26617836		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	26617836	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	23684102, 25652467		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	28454121	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	25911104	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	28454121	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	28454121	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	33960231	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	19801974, 24504364, 27107895, 28744404, 29701902, 30524945		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	26617836		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	25109837		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	25911104, 28454121		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	26617836		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	16966434		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	21777376, 25109837, 25706482, 25911104, 26617836, 31545467		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	25911104		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	25109837		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	32019121	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	33667708	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	33960231, 34738482	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	8816445		★★★★★ ★☆☆☆☆ Found in Text Mining only

KLF17 (KLF transcription factor 17)