FCRLB (Fc receptor like B)

Gene

• Entrez ID: 127943
• Gene name: Fc receptor like B
• Gene symbol: FCRLB
• Synonyms (NCBI Gene): FCRL2, FCRLM2, FCRLY, FREB-2, FREB2, FcRY
• Chromosome: 1
• Chromosome location: 1q23.3
• Summary: FCRL2 belongs to the Fc receptor family. Fc receptors are involved in phagocytosis, antibody-dependent cell cytotoxicity, immediate hypersensitivity, and transcytosis of immunoglobulins via their ability to bind immunoglobulin (Ig) constant regions (Chika

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT441910	hsa-miR-192-3p	PAR-CLIP	22100165
MIRT441910	hsa-miR-192-3p	PAR-CLIP	22100165
MIRT994222	hsa-miR-1914	CLIP-seq
MIRT994223	hsa-miR-193a-3p	CLIP-seq
MIRT994224	hsa-miR-193b	CLIP-seq
MIRT994225	hsa-miR-2467-3p	CLIP-seq
MIRT994226	hsa-miR-302a	CLIP-seq
MIRT994227	hsa-miR-302b	CLIP-seq
MIRT994228	hsa-miR-302c	CLIP-seq
MIRT994229	hsa-miR-302d	CLIP-seq
MIRT994230	hsa-miR-302e	CLIP-seq
MIRT994231	hsa-miR-3158-5p	CLIP-seq
MIRT994232	hsa-miR-3173-3p	CLIP-seq
MIRT994233	hsa-miR-3179	CLIP-seq
MIRT994234	hsa-miR-3200-5p	CLIP-seq
MIRT994235	hsa-miR-3613-3p	CLIP-seq
MIRT994236	hsa-miR-3678-3p	CLIP-seq
MIRT994237	hsa-miR-372	CLIP-seq
MIRT994238	hsa-miR-373	CLIP-seq
MIRT994239	hsa-miR-4777-3p	CLIP-seq
MIRT994240	hsa-miR-4794	CLIP-seq
MIRT994241	hsa-miR-513c	CLIP-seq
MIRT994242	hsa-miR-514b-5p	CLIP-seq
MIRT994243	hsa-miR-520a-3p	CLIP-seq
MIRT994244	hsa-miR-520b	CLIP-seq
MIRT994245	hsa-miR-520c-3p	CLIP-seq
MIRT994246	hsa-miR-520d-3p	CLIP-seq
MIRT994247	hsa-miR-520e	CLIP-seq
MIRT994248	hsa-miR-548a-3p	CLIP-seq
MIRT994249	hsa-miR-548ae	CLIP-seq
MIRT994250	hsa-miR-548aj	CLIP-seq
MIRT994251	hsa-miR-548am	CLIP-seq
MIRT994252	hsa-miR-548e	CLIP-seq
MIRT994253	hsa-miR-548f	CLIP-seq
MIRT994254	hsa-miR-548x	CLIP-seq
MIRT994255	hsa-miR-596	CLIP-seq
MIRT994256	hsa-miR-645	CLIP-seq
MIRT994257	hsa-miR-892b	CLIP-seq
MIRT994258	hsa-miR-935	CLIP-seq
MIRT994225	hsa-miR-2467-3p	CLIP-seq
MIRT994231	hsa-miR-3158-5p	CLIP-seq
MIRT994232	hsa-miR-3173-3p	CLIP-seq
MIRT994236	hsa-miR-3678-3p	CLIP-seq
MIRT994255	hsa-miR-596	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004888	Function	Transmembrane signaling receptor activity	IBA
GO:0005737	Component	Cytoplasm	IDA	15815692
GO:0005737	Component	Cytoplasm	IEA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0007166	Process	Cell surface receptor signaling pathway	IBA
GO:0009897	Component	External side of plasma membrane	IBA
GO:0016064	Process	Immunoglobulin mediated immune response	IBA
GO:0050777	Process	Negative regulation of immune response	IEA

Other IDs

• MIM: 609251
• HGNC: 26431
• e!Ensembl: ENSG00000162746

Protein

• UniProt ID: Q6BAA4
• Protein name: Fc receptor-like B (Fc receptor homolog expressed in B-cells protein 2) (FREB-2) (Fc receptor-like and mucin-like protein 2) (Fc receptor-like protein 2) (Fc receptor-related protein Y) (FcRY)
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF13895	Ig_2	22 → 100	Immunoglobulin domain	Domain
  PF13895	Ig_2	104 → 190	Immunoglobulin domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed at low levels. Expressed in B-lymphocytes. Detected in tonsil, lung, kidney, spleen and placenta. Expressed by a small subset of germinal center B-cells in tonsils and by melanocytes (at protein level). {ECO:0000269|PubMed:15
• Sequence:

  MWPLTALLLLVPSSGQAATLEKPILSLHPPWTTIFKGERVTLKCDGYHPLLLELQPISTL
  WYLGHLLLPSHKKSIEVQTPGVYRCQTRGAPVSDPIHLSVSNDWLILQVPYAPVFEGEPL
  VLRCRGWYDKVVYKLHYYHDGQAVRYFHSSANYTVLQARASDSGRYQCSGTMRIPVESAP
  MFSAKVAVTVQELFRAPVLRVMGPREARGAALGGVVLRCDTRLHPQKRDTPLQFAFYKYS
  RAVRRFDWGAEYTVPEPEVEELESYWCEAATATRSVRKRSPWLQLPGPGSPLDPASTTAP
  APWAAALAPGNRPLSFRKPPVSRSVPLVTSVRNTTSTGLQFPASGAPTAGPPACAPPTPL
  EQSAGALKPDVDLLLREMQLLKGLLSRVVLELKEPQALRELRGTPETPTSHFAVSPGTPE
  TTPVES

• Sequence length: 426

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
NEUTROPENIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Autoimmune Diseases	Autoimmune Diseases	BEFREE	17200162		★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	18704934, 19682311		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	37684436	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	22038218	Stimulate	★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	18314442, 18704934, 19682311		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	LHGDN	18314442, 18704934		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	36394757	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	23593433	Associate	★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	25738996		★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	BEFREE	25738996		★☆☆☆☆ Found in Text Mining only
Hematological Disease	Hematological Disease	BEFREE	19682311		★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	22038218	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis B Chronic	Hepatitis b	Pubtator	22038218	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	24504816	Associate	★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	23593433		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	22038218	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	33589541	Stimulate	★☆☆☆☆ Found in Text Mining only