GOLT1A (golgi transport 1A)

Gene

• Entrez ID: 127845
• Gene name: Golgi transport 1A
• Gene symbol: GOLT1A
• Synonyms (NCBI Gene): CGI-141, GOT1, GOT1B, HMFN1187, YMR292W, hGOT1b
• Chromosome: 1
• Chromosome location: 1q32.1

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT2237454	hsa-miR-1237	CLIP-seq
MIRT2237455	hsa-miR-1248	CLIP-seq
MIRT2237456	hsa-miR-1299	CLIP-seq
MIRT2237457	hsa-miR-2110	CLIP-seq
MIRT2237458	hsa-miR-3150a-3p	CLIP-seq
MIRT2237459	hsa-miR-3175	CLIP-seq
MIRT2237460	hsa-miR-3667-3p	CLIP-seq
MIRT2237461	hsa-miR-378	CLIP-seq
MIRT2237462	hsa-miR-378b	CLIP-seq
MIRT2237463	hsa-miR-378c	CLIP-seq
MIRT2237464	hsa-miR-378d	CLIP-seq
MIRT2237465	hsa-miR-378e	CLIP-seq
MIRT2237466	hsa-miR-378f	CLIP-seq
MIRT2237467	hsa-miR-378h	CLIP-seq
MIRT2237468	hsa-miR-378i	CLIP-seq
MIRT2237469	hsa-miR-422a	CLIP-seq
MIRT2237470	hsa-miR-4638-3p	CLIP-seq
MIRT2237471	hsa-miR-4782-5p	CLIP-seq
MIRT2237472	hsa-miR-516b	CLIP-seq
MIRT2237473	hsa-miR-939	CLIP-seq
MIRT2681766	hsa-miR-28-5p	CLIP-seq
MIRT2681767	hsa-miR-3139	CLIP-seq
MIRT2681768	hsa-miR-3670	CLIP-seq
MIRT2681769	hsa-miR-3691-3p	CLIP-seq
MIRT2681770	hsa-miR-640	CLIP-seq
MIRT2681771	hsa-miR-708	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000137	Component	Golgi cis cisterna	IDA	10406798
GO:0000139	Component	Golgi membrane	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005635	Component	Nuclear envelope	IDA	10406798
GO:0005737	Component	Cytoplasm	IEA
GO:0005783	Component	Endoplasmic reticulum	IBA
GO:0005783	Component	Endoplasmic reticulum	IDA	10406798
GO:0005794	Component	Golgi apparatus	IEA
GO:0005802	Component	Trans-Golgi network	IDA	10406798
GO:0005829	Component	Cytosol	IEA
GO:0006888	Process	Endoplasmic reticulum to Golgi vesicle-mediated transport	IEA
GO:0006888	Process	Endoplasmic reticulum to Golgi vesicle-mediated transport	ISS	10406798
GO:0012505	Component	Endomembrane system	IEA
GO:0015031	Process	Protein transport	IEA
GO:0016020	Component	Membrane	IBA
GO:0016020	Component	Membrane	IEA
GO:0016192	Process	Vesicle-mediated transport	IEA
GO:0042147	Process	Retrograde transport, endosome to Golgi	IEA

Other IDs

• MIM: 620633
• HGNC: 24766
• e!Ensembl: ENSG00000174567

Protein

• UniProt ID: Q6ZVE7
• Protein name: Vesicle transport protein GOT1A (Golgi transport 1 homolog A) (hGOT1b)
• Protein function: May be involved in fusion of ER-derived transport vesicles with the Golgi complex.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF04178	Got1	11 → 114	Got1/Sft2-like family	Family

• Sequence:

  MISITEWQKIGVGITGFGIFFILFGTLLYFDSVLLAFGNLLFLTGLSLIIGLRKTFWFFF
  QRHKLKGTSFLLGGVVIVLLRWPLLGMFLETYGFFSLFKGFFPVAFGFLGNVCNIPFLGA
  LFRRLQGTSSMV

• Sequence length: 132

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Cervical cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MELANOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	29751795		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	40033432	Associate	★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	29731362, 31470862		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	31647966		★☆☆☆☆ Found in Text Mining only
Biliary cirrhosis	Biliary cirrhosis	LHGDN	18752324		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	26255816, 29661856, 29751795		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	26255816	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	28737263		★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	23535601, 25595905	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	27711126	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	24407245		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	28978096		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervix carcinoma	Cervix carcinoma	BEFREE	28978096		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	21049047		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	28314989		★☆☆☆☆ Found in Text Mining only
CORONARY ARTERY DISEASE, AUTOSOMAL DOMINANT, 1	Coronary artery disease	GWASDB_DG	23202125		★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	24186075		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	28245795		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	28245795	Inhibit	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	28245795		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	32484805	Associate	★☆☆☆☆ Found in Text Mining only
Homocystinuria	Homocystinuria	BEFREE	24891521		★☆☆☆☆ Found in Text Mining only
Hydrocephalus Normal Pressure	Normal pressure hydrocephalus	Pubtator	40033432	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure	Kidney Failure	BEFREE	30407841		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	28737263	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	26255816, 29661856		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	24186075		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	28737263		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	30365304, 30591220, 31787239		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	28737263, 29751795		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	28978096		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	30035324		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	15347626, 22269963		★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	29751795		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	16757412, 18310541		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	18310541	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	25719198, 27871087, 28314989, 28978096, 30591220, 30730850, 30895393		★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	27871087, 28097640, 28789624, 29502008		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	26173780		★☆☆☆☆ Found in Text Mining only
Ochoa syndrome	Ochoa Syndrome	BEFREE	10360399, 12707951		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	37960823	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	30365304, 30591220, 31787239		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	29731362, 31470862		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	30365304, 33832516	Associate	★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	LHGDN	16681433		★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Diseases	Vascular Diseases	GWASCAT_DG	27082954		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	32111915	Associate	★☆☆☆☆ Found in Text Mining only
Pseudohyperkalemia Cardiff	Pseudohyperkalemia Cardiff	BEFREE	10507990		★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	28025995	Associate	★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	30407841		★☆☆☆☆ Found in Text Mining only
Severe Acute Respiratory Syndrome	Severe Acute Respiratory Syndrome	LHGDN	15306699		★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	BEFREE	30983975		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	33228592	Associate	★☆☆☆☆ Found in Text Mining only
Xeroderma Pigmentosum	Xeroderma Pigmentosum	BEFREE	30885940		★☆☆☆☆ Found in Text Mining only