OSCP1 (organic solute carrier partner 1)

Gene

• Entrez ID: 127700
• Gene name: Organic solute carrier partner 1
• Gene symbol: OSCP1
• Synonyms (NCBI Gene): C1orf102, NOR1
• Chromosome: 1
• Chromosome location: 1p34.3

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT035529	hsa-miR-638	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23554459
MIRT035529	hsa-miR-638	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23554459
MIRT646709	hsa-miR-33a-5p	HITS-CLIP	23824327
MIRT646708	hsa-miR-33b-5p	HITS-CLIP	23824327
MIRT646707	hsa-miR-6875-3p	HITS-CLIP	23824327
MIRT646706	hsa-miR-4659a-3p	HITS-CLIP	23824327
MIRT646705	hsa-miR-4659b-3p	HITS-CLIP	23824327
MIRT646709	hsa-miR-33a-5p	HITS-CLIP	23824327
MIRT646708	hsa-miR-33b-5p	HITS-CLIP	23824327
MIRT646707	hsa-miR-6875-3p	HITS-CLIP	23824327
MIRT646706	hsa-miR-4659a-3p	HITS-CLIP	23824327
MIRT646705	hsa-miR-4659b-3p	HITS-CLIP	23824327
MIRT2287824	hsa-miR-338-3p	CLIP-seq
MIRT2287825	hsa-miR-4530	CLIP-seq
MIRT2585945	hsa-miR-103a	CLIP-seq
MIRT2585946	hsa-miR-107	CLIP-seq
MIRT2585947	hsa-miR-1285	CLIP-seq
MIRT2585948	hsa-miR-135a	CLIP-seq
MIRT2585949	hsa-miR-135b	CLIP-seq
MIRT2585950	hsa-miR-15a	CLIP-seq
MIRT2585951	hsa-miR-15b	CLIP-seq
MIRT2585952	hsa-miR-16	CLIP-seq
MIRT2585953	hsa-miR-1915	CLIP-seq
MIRT2585954	hsa-miR-195	CLIP-seq
MIRT2585955	hsa-miR-199a-3p	CLIP-seq
MIRT2585956	hsa-miR-199b-3p	CLIP-seq
MIRT2585957	hsa-miR-2355-5p	CLIP-seq
MIRT2585958	hsa-miR-3121-3p	CLIP-seq
MIRT2585959	hsa-miR-3129-5p	CLIP-seq
MIRT2585960	hsa-miR-3187-5p	CLIP-seq
MIRT2585961	hsa-miR-3675-5p	CLIP-seq
MIRT2585962	hsa-miR-377	CLIP-seq
MIRT2585963	hsa-miR-378g	CLIP-seq
MIRT2585964	hsa-miR-424	CLIP-seq
MIRT2585965	hsa-miR-4314	CLIP-seq
MIRT2585966	hsa-miR-4486	CLIP-seq
MIRT2585967	hsa-miR-4524	CLIP-seq
MIRT2585968	hsa-miR-4640-5p	CLIP-seq
MIRT2585969	hsa-miR-4726-5p	CLIP-seq
MIRT2585970	hsa-miR-4797-3p	CLIP-seq
MIRT2585971	hsa-miR-4803	CLIP-seq
MIRT2585972	hsa-miR-486-3p	CLIP-seq
MIRT2585973	hsa-miR-497	CLIP-seq
MIRT2585974	hsa-miR-503	CLIP-seq
MIRT2585975	hsa-miR-612	CLIP-seq
MIRT2585976	hsa-miR-646	CLIP-seq
MIRT2585977	hsa-miR-936	CLIP-seq
MIRT2585948	hsa-miR-135a	CLIP-seq
MIRT2585949	hsa-miR-135b	CLIP-seq
MIRT2585955	hsa-miR-199a-3p	CLIP-seq
MIRT2585956	hsa-miR-199b-3p	CLIP-seq
MIRT2585958	hsa-miR-3121-3p	CLIP-seq
MIRT2585959	hsa-miR-3129-5p	CLIP-seq
MIRT2585962	hsa-miR-377	CLIP-seq
MIRT2585970	hsa-miR-4797-3p	CLIP-seq
MIRT2585971	hsa-miR-4803	CLIP-seq
MIRT2585977	hsa-miR-936	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	19727524
GO:0005737	Component	Cytoplasm	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0009925	Component	Basal plasma membrane	IDA	16006562
GO:0009925	Component	Basal plasma membrane	IEA
GO:0016020	Component	Membrane	IEA
GO:0022857	Function	Transmembrane transporter activity	IMP	16006562
GO:1990961	Process	Xenobiotic detoxification by transmembrane export across the plasma membrane	IMP	16006562

Other IDs

• MIM: 608854
• HGNC: 29971
• e!Ensembl: ENSG00000116885

Protein

• UniProt ID: Q8WVF1
• Protein name: Protein OSCP1 (hOSCP1) (Organic solute transport protein 1) (Oxidored-nitro domain-containing protein 1)
• Protein function: May be involved in drug clearance in the placenta.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF10188	Oscp1	17 → 199	Organic solute transport protein 1	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed predominantly in testis, also found in placenta and to a lesser extent in thymus and small intestine; abundantly expressed in tumor-derived cell lines (PubMed:16006562). Ubiquitously expressed (PubMed:12819961). {ECO:0000269|
• Sequence:

  MSVRTLPLLFLNLGGEMLYILDQRLRAQNIPGDKARKDEWTEVDRKRVLNDIISTMFNRK
  FMEELFKPQELYSKKALRTVYERLAHASIMKLNQASMDKLYDLMTMAFKYQVLLCPRPKD
  VLLVTFNHLDTIKGFIRDSPTILQQVDETLRQLTEIYGGLSAGEFQLIRQTLLIFFQDLH
  IRVSMFLKDKVQNNNGRFVLPVSGPVPWGTEVPGLIRMFNNKGEEVKRIEFKHGGNYVPA
  PKEGSFELYGDRVLKLGTNMYSVNQPVETHVSGSSKNLASWTQESIAPNPLAKEELNFLA
  RLMGGMEIKKPSGPEPGFRLNLFTTDEEEEQAALTRPEELSYEVINIQATQDQQRSEELA
  RIMGEFEITEQPRLSTSKGDDLLAMMDEL

• Sequence length: 389

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
AMINO ACID METABOLISM DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, BASAL CELL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC RETINOPATHY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	23247046		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	29047330		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	20558821, 24806827		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	20558821, 24806827		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	29414782		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10854708, 9070291		★☆☆☆☆ Found in Text Mining only
Cancer of Nasopharynx	Nasopharyngeal Cancer	BEFREE	23831407		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	29135101, 36918874	Associate	★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	25118646		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	25118646		★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	BEFREE	12543801, 15262426		★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	28791396		★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	23124592		★☆☆☆☆ Found in Text Mining only
Extraskeletal Myxoid Chondrosarcoma	Extraskeletal Myxoid Chondrosarcoma	BEFREE	12543801, 15188455, 15212958, 15262426, 16112421		★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	BEFREE	23550059		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	28791396		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	37962027	Associate	★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	28367242		★☆☆☆☆ Found in Text Mining only
Hereditary Sensory Autonomic Neuropathy, Type 1	Hereditary sensory and autonomic neuropathy	BEFREE	9722951		★☆☆☆☆ Found in Text Mining only
Holoprosencephaly	Holoprosencephaly	BEFREE	15523651		★☆☆☆☆ Found in Text Mining only
Hypercalcemia	Hypercalcemia	BEFREE	10741714		★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	20558821		★☆☆☆☆ Found in Text Mining only
Hyperparathyroidism, Secondary	Hyperparathyroidism	BEFREE	12813173, 28451892		★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	17096060		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	12813173, 21803736, 23247046		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	17515897, 18523155, 23247046		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	23462179, 28232113, 29135101, 29227538		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	28791396		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10854708, 9070291		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	28232113		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of nasopharynx	Nasopharyngeal carcinoma	BEFREE	23831407		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	25118646		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	23124592, 25118646, 27891591, 28367242		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	25118646		★☆☆☆☆ Found in Text Mining only
Monocytosis	Monocytosis	BEFREE	24806827		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	BEFREE	15781666		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	12819961, 19727524, 21803736, 23124592, 23831407, 24657653, 24788728, 25118646, 27891591, 28367242		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	12543801, 12819961, 15212958, 21803736, 23124592, 23831407, 24657653, 25118646, 27891591, 28232113, 28367242, 29227538		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	7553599		★☆☆☆☆ Found in Text Mining only
Niemann-Pick Disease, Type C	Niemann-Pick Disease	BEFREE	24657653		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	22143616		★☆☆☆☆ Found in Text Mining only
PACHYONYCHIA CONGENITA 3	Pachyonychia Congenita	BEFREE	10741714		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	25118646		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	30508646		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	11884470		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	GWASCAT_DG	27846195		★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	23550059		★☆☆☆☆ Found in Text Mining only