Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	127018
Gene name	Lysophospholipase like 1
Gene symbol	LYPLAL1
Synonyms (NCBI Gene)	Q96AV0
Chromosome	1
Chromosome location	1q41

181

Show/Hide all (181)

miRTarBase ID	miRNA	Experiments	Reference
MIRT185100	hsa-miR-7-1-3p	PAR-CLIP	23592263
MIRT185101	hsa-miR-7-2-3p	PAR-CLIP	23592263
MIRT456518	hsa-miR-1245a	PAR-CLIP	23592263
MIRT456517	hsa-miR-8079	PAR-CLIP	23592263
MIRT456516	hsa-miR-8062	PAR-CLIP	23592263
MIRT185112	hsa-miR-3074-3p	PAR-CLIP	23592263
MIRT185114	hsa-miR-5094	PAR-CLIP	23592263
MIRT185107	hsa-miR-511-3p	PAR-CLIP	23592263
MIRT185116	hsa-miR-5693	PAR-CLIP	23592263
MIRT185104	hsa-miR-194-3p	PAR-CLIP	23592263
MIRT185097	hsa-miR-30a-5p	PAR-CLIP	23592263
MIRT185102	hsa-miR-30b-5p	PAR-CLIP	23592263
MIRT185098	hsa-miR-30c-5p	PAR-CLIP	23592263
MIRT185099	hsa-miR-30d-5p	PAR-CLIP	23592263
MIRT185105	hsa-miR-30e-5p	PAR-CLIP	23592263
MIRT185110	hsa-miR-1257	PAR-CLIP	23592263
MIRT185100	hsa-miR-7-1-3p	PAR-CLIP	23592263
MIRT185101	hsa-miR-7-2-3p	PAR-CLIP	23592263
MIRT456518	hsa-miR-1245a	PAR-CLIP	23592263
MIRT456517	hsa-miR-8079	PAR-CLIP	23592263
MIRT456516	hsa-miR-8062	PAR-CLIP	23592263
MIRT185112	hsa-miR-3074-3p	PAR-CLIP	23592263
MIRT185114	hsa-miR-5094	PAR-CLIP	23592263
MIRT185107	hsa-miR-511-3p	PAR-CLIP	23592263
MIRT185116	hsa-miR-5693	PAR-CLIP	23592263
MIRT185104	hsa-miR-194-3p	PAR-CLIP	23592263
MIRT185097	hsa-miR-30a-5p	PAR-CLIP	23592263
MIRT185102	hsa-miR-30b-5p	PAR-CLIP	23592263
MIRT185098	hsa-miR-30c-5p	PAR-CLIP	23592263
MIRT185099	hsa-miR-30d-5p	PAR-CLIP	23592263
MIRT185105	hsa-miR-30e-5p	PAR-CLIP	23592263
MIRT185110	hsa-miR-1257	PAR-CLIP	23592263
MIRT1123506	hsa-miR-103b	CLIP-seq
MIRT1123507	hsa-miR-1264	CLIP-seq
MIRT1123508	hsa-miR-15a	CLIP-seq
MIRT1123509	hsa-miR-15b	CLIP-seq
MIRT1123510	hsa-miR-16	CLIP-seq
MIRT1123511	hsa-miR-195	CLIP-seq
MIRT1123512	hsa-miR-2278	CLIP-seq
MIRT1123513	hsa-miR-3143	CLIP-seq
MIRT1123514	hsa-miR-3146	CLIP-seq
MIRT1123515	hsa-miR-3153	CLIP-seq
MIRT1123516	hsa-miR-3163	CLIP-seq
MIRT1123517	hsa-miR-323-3p	CLIP-seq
MIRT1123518	hsa-miR-34b	CLIP-seq
MIRT1123519	hsa-miR-3617	CLIP-seq
MIRT1123520	hsa-miR-376a	CLIP-seq
MIRT1123521	hsa-miR-376b	CLIP-seq
MIRT1123522	hsa-miR-3940-5p	CLIP-seq
MIRT1123523	hsa-miR-424	CLIP-seq
MIRT1123524	hsa-miR-4507	CLIP-seq
MIRT1123525	hsa-miR-4522	CLIP-seq
MIRT1123526	hsa-miR-4524	CLIP-seq
MIRT1123527	hsa-miR-4668-5p	CLIP-seq
MIRT1123528	hsa-miR-4719	CLIP-seq
MIRT1123529	hsa-miR-4764-3p	CLIP-seq
MIRT1123530	hsa-miR-497	CLIP-seq
MIRT1123531	hsa-miR-503	CLIP-seq
MIRT1123532	hsa-miR-5096	CLIP-seq
MIRT1123533	hsa-miR-513b	CLIP-seq
MIRT1123534	hsa-miR-543	CLIP-seq
MIRT1123535	hsa-miR-548c-3p	CLIP-seq
MIRT1123536	hsa-miR-577	CLIP-seq
MIRT1123537	hsa-miR-584	CLIP-seq
MIRT1123538	hsa-miR-641	CLIP-seq
MIRT1123539	hsa-miR-646	CLIP-seq
MIRT1123540	hsa-miR-664	CLIP-seq
MIRT1123507	hsa-miR-1264	CLIP-seq
MIRT1123515	hsa-miR-3153	CLIP-seq
MIRT1123517	hsa-miR-323-3p	CLIP-seq
MIRT1123527	hsa-miR-4668-5p	CLIP-seq
MIRT1123528	hsa-miR-4719	CLIP-seq
MIRT1123506	hsa-miR-103b	CLIP-seq
MIRT1123507	hsa-miR-1264	CLIP-seq
MIRT2265381	hsa-miR-1343	CLIP-seq
MIRT1123508	hsa-miR-15a	CLIP-seq
MIRT1123509	hsa-miR-15b	CLIP-seq
MIRT1123510	hsa-miR-16	CLIP-seq
MIRT1123511	hsa-miR-195	CLIP-seq
MIRT1123515	hsa-miR-3153	CLIP-seq
MIRT2265382	hsa-miR-3690	CLIP-seq
MIRT1123520	hsa-miR-376a	CLIP-seq
MIRT1123521	hsa-miR-376b	CLIP-seq
MIRT1123523	hsa-miR-424	CLIP-seq
MIRT2265383	hsa-miR-4254	CLIP-seq
MIRT1123526	hsa-miR-4524	CLIP-seq
MIRT2265384	hsa-miR-4666-3p	CLIP-seq
MIRT2265385	hsa-miR-4704-3p	CLIP-seq
MIRT2265386	hsa-miR-4796-5p	CLIP-seq
MIRT1123530	hsa-miR-497	CLIP-seq
MIRT1123531	hsa-miR-503	CLIP-seq
MIRT2265387	hsa-miR-630	CLIP-seq
MIRT1123539	hsa-miR-646	CLIP-seq
MIRT1123540	hsa-miR-664	CLIP-seq
MIRT1123507	hsa-miR-1264	CLIP-seq
MIRT1123515	hsa-miR-3153	CLIP-seq
MIRT1123527	hsa-miR-4668-5p	CLIP-seq
MIRT1123529	hsa-miR-4764-3p	CLIP-seq
MIRT2453541	hsa-miR-3065-5p	CLIP-seq
MIRT2453542	hsa-miR-4668-3p	CLIP-seq
MIRT2453543	hsa-miR-548a-3p	CLIP-seq
MIRT1123535	hsa-miR-548c-3p	CLIP-seq
MIRT2453544	hsa-miR-548e	CLIP-seq
MIRT2453545	hsa-miR-548f	CLIP-seq
MIRT2564475	hsa-miR-1185	CLIP-seq
MIRT1123507	hsa-miR-1264	CLIP-seq
MIRT2564476	hsa-miR-1294	CLIP-seq
MIRT2564477	hsa-miR-1307	CLIP-seq
MIRT2564478	hsa-miR-137	CLIP-seq
MIRT2564479	hsa-miR-146a	CLIP-seq
MIRT2564480	hsa-miR-146b-5p	CLIP-seq
MIRT1123508	hsa-miR-15a	CLIP-seq
MIRT1123509	hsa-miR-15b	CLIP-seq
MIRT1123510	hsa-miR-16	CLIP-seq
MIRT2564481	hsa-miR-192	CLIP-seq
MIRT1123511	hsa-miR-195	CLIP-seq
MIRT2564482	hsa-miR-215	CLIP-seq
MIRT2564483	hsa-miR-2276	CLIP-seq
MIRT1123512	hsa-miR-2278	CLIP-seq
MIRT2564484	hsa-miR-3129-3p	CLIP-seq
MIRT2564485	hsa-miR-3140-5p	CLIP-seq
MIRT1123515	hsa-miR-3153	CLIP-seq
MIRT1123516	hsa-miR-3163	CLIP-seq
MIRT2564486	hsa-miR-3605-5p	CLIP-seq
MIRT2564487	hsa-miR-3647-3p	CLIP-seq
MIRT2564488	hsa-miR-3655	CLIP-seq
MIRT2564489	hsa-miR-3661	CLIP-seq
MIRT2564490	hsa-miR-3671	CLIP-seq
MIRT2564491	hsa-miR-3679-5p	CLIP-seq
MIRT2564492	hsa-miR-3682-5p	CLIP-seq
MIRT2564493	hsa-miR-3924	CLIP-seq
MIRT1123523	hsa-miR-424	CLIP-seq
MIRT2564494	hsa-miR-4266	CLIP-seq
MIRT2564495	hsa-miR-4282	CLIP-seq
MIRT2564496	hsa-miR-431	CLIP-seq
MIRT2564497	hsa-miR-4316	CLIP-seq
MIRT2564498	hsa-miR-4477a	CLIP-seq
MIRT2564499	hsa-miR-4638-5p	CLIP-seq
MIRT2564500	hsa-miR-4648	CLIP-seq
MIRT2564501	hsa-miR-4654	CLIP-seq
MIRT1123527	hsa-miR-4668-5p	CLIP-seq
MIRT2564502	hsa-miR-4680-3p	CLIP-seq
MIRT1123528	hsa-miR-4719	CLIP-seq
MIRT2564503	hsa-miR-4760-5p	CLIP-seq
MIRT1123529	hsa-miR-4764-3p	CLIP-seq
MIRT2564504	hsa-miR-4769-5p	CLIP-seq
MIRT2564505	hsa-miR-4786-5p	CLIP-seq
MIRT2564506	hsa-miR-4795-3p	CLIP-seq
MIRT1123530	hsa-miR-497	CLIP-seq
MIRT2564507	hsa-miR-511	CLIP-seq
MIRT1123533	hsa-miR-513b	CLIP-seq
MIRT2564508	hsa-miR-578	CLIP-seq
MIRT2564509	hsa-miR-580	CLIP-seq
MIRT2564510	hsa-miR-581	CLIP-seq
MIRT2564511	hsa-miR-586	CLIP-seq
MIRT2564512	hsa-miR-589	CLIP-seq
MIRT2564513	hsa-miR-631	CLIP-seq
MIRT2564514	hsa-miR-769-5p	CLIP-seq
MIRT2564515	hsa-miR-802	CLIP-seq
MIRT1123507	hsa-miR-1264	CLIP-seq
MIRT2564478	hsa-miR-137	CLIP-seq
MIRT2564481	hsa-miR-192	CLIP-seq
MIRT2564482	hsa-miR-215	CLIP-seq
MIRT2564483	hsa-miR-2276	CLIP-seq
MIRT2564485	hsa-miR-3140-5p	CLIP-seq
MIRT1123515	hsa-miR-3153	CLIP-seq
MIRT2564488	hsa-miR-3655	CLIP-seq
MIRT2564489	hsa-miR-3661	CLIP-seq
MIRT2564494	hsa-miR-4266	CLIP-seq
MIRT2564496	hsa-miR-431	CLIP-seq
MIRT2564500	hsa-miR-4648	CLIP-seq
MIRT2564501	hsa-miR-4654	CLIP-seq
MIRT1123527	hsa-miR-4668-5p	CLIP-seq
MIRT2564502	hsa-miR-4680-3p	CLIP-seq
MIRT1123529	hsa-miR-4764-3p	CLIP-seq
MIRT2564504	hsa-miR-4769-5p	CLIP-seq
MIRT2564507	hsa-miR-511	CLIP-seq
MIRT2564508	hsa-miR-578	CLIP-seq
MIRT2564509	hsa-miR-580	CLIP-seq
MIRT2564513	hsa-miR-631	CLIP-seq
MIRT2564514	hsa-miR-769-5p	CLIP-seq

Show/Hide all (17)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004622	Function	Phosphatidylcholine lysophospholipase activity	NAS	12706107
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	IEA
GO:0008474	Function	Palmitoyl-(protein) hydrolase activity	IBA
GO:0008474	Function	Palmitoyl-(protein) hydrolase activity	IDA	37802025
GO:0008474	Function	Palmitoyl-(protein) hydrolase activity	IEA
GO:0016298	Function	Lipase activity	IDA	22052940
GO:0016787	Function	Hydrolase activity	IEA
GO:0016788	Function	Hydrolase activity, acting on ester bonds	IDA	22052940
GO:0042997	Process	Negative regulation of Golgi to plasma membrane protein transport	IBA
GO:0098734	Process	Macromolecule depalmitoylation	IEA
GO:0140896	Process	CGAS/STING signaling pathway	IDA	32911482, 32912999
GO:0160049	Process	Negative regulation of cGAS/STING signaling pathway	IDA	37802025

MIM	HGNC	e!Ensembl
616548	20440	ENSG00000143353

Q5VWZ2

Protein name

Lysophospholipase-like protein 1 (EC 3.1.2.22)

Protein function

Palmitoyl thioesterase that catalyzes depalmitoylation of CGAS and KCNMA1 (PubMed:22052940, PubMed:22399288, PubMed:37802025). Acts as a regulator of innate immunity by mediating depalmitoylation of CGAS, thereby preventing CGAS homodimerization

PDB

3U0V , 5KRE

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02230	Abhydrolase_2	9 → 229	Phospholipase/Carboxylesterase	Domain

Sequence

MAAASGSVLQRCIVSPAGRHSASLIFLHGSGDSGQGLRMWIKQVLNQDLTFQHIKIIYPT
APPRSYTPMKGGISNVWFDRFKITNDCPEHLESIDVMCQVLTDLIDEEVKSGIKKNRILI
GGFSMGGCMAIHLAYRNHQDVAGVFALSSFLNKASAVYQALQKSNGVLPELFQCHGTADE
LVLHSWAEETNSMLKSLGVTTKFHSFPNVYHELSKTELDILKLWILTKLPGEMEKQK

Sequence length

237

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OPEN-ANGLE GLAUCOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (20)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Alzheimer Disease	Alzheimer disease	Pubtator	28539126	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Body Weight	Body weight	Pubtator	27181159	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	29358691	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	29358691		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	Pubtator	36759651	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	23416328, 28594920, 29648650		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver Alcoholic	Fatty liver, alcoholic	Pubtator	26845607	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	Pubtator	39342991	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	28645872		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	27752939	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	27773974	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myopia	Myopia	BEFREE	22685421		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	24477042, 30646922		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	17609260	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	21674055, 21796137, 28645872, 30639359		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	21674055, 23349760, 27752939, 27773974, 29307798	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	37713870	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	31682594	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	23416328, 28594920, 29648650		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	36974635	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

LYPLAL1 (lysophospholipase like 1)