CNTF (ciliary neurotrophic factor)

Gene

• Entrez ID: 1270
• Gene name: Ciliary neurotrophic factor
• Gene symbol: CNTF
• Synonyms (NCBI Gene): HCNTF
• Chromosome: 11
• Chromosome location: 11q12.1
• Summary: The protein encoded by this gene is a polypeptide hormone whose actions appear to be restricted to the nervous system where it promotes neurotransmitter synthesis and neurite outgrowth in certain neuronal populations. The protein is a potent survival fact

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT608879	hsa-miR-511-3p	HITS-CLIP	21572407
MIRT608877	hsa-miR-6867-5p	HITS-CLIP	21572407
MIRT608878	hsa-miR-8068	HITS-CLIP	21572407
MIRT608876	hsa-miR-6818-5p	HITS-CLIP	21572407
MIRT608875	hsa-miR-147a	HITS-CLIP	21572407
MIRT608874	hsa-miR-5010-3p	HITS-CLIP	21572407
MIRT608873	hsa-miR-4455	HITS-CLIP	21572407
MIRT608872	hsa-miR-574-5p	HITS-CLIP	21572407
MIRT528928	hsa-miR-8485	HITS-CLIP	23313552
MIRT528928	hsa-miR-8485	HITS-CLIP	23313552
MIRT528928	hsa-miR-8485	HITS-CLIP	23824327
MIRT528928	hsa-miR-8485	HITS-CLIP	23824327
MIRT528927	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT528928	hsa-miR-8485	HITS-CLIP	23824327
MIRT528928	hsa-miR-8485	HITS-CLIP	23824327
MIRT528928	hsa-miR-8485	HITS-CLIP	23824327
MIRT528928	hsa-miR-8485	HITS-CLIP	23824327
MIRT528928	hsa-miR-8485	HITS-CLIP	23824327
MIRT528928	hsa-miR-8485	HITS-CLIP	23824327
MIRT528928	hsa-miR-8485	HITS-CLIP	23824327
MIRT608879	hsa-miR-511-3p	HITS-CLIP	23824327
MIRT608877	hsa-miR-6867-5p	HITS-CLIP	23824327
MIRT608878	hsa-miR-8068	HITS-CLIP	23824327
MIRT608876	hsa-miR-6818-5p	HITS-CLIP	23824327
MIRT608875	hsa-miR-147a	HITS-CLIP	23824327
MIRT608874	hsa-miR-5010-3p	HITS-CLIP	23824327
MIRT608873	hsa-miR-4455	HITS-CLIP	23824327
MIRT608872	hsa-miR-574-5p	HITS-CLIP	23824327
MIRT528928	hsa-miR-8485	HITS-CLIP	23824327
MIRT528928	hsa-miR-8485	HITS-CLIP	23824327
MIRT528928	hsa-miR-8485	HITS-CLIP	23824327
MIRT528928	hsa-miR-8485	HITS-CLIP	23824327
MIRT528928	hsa-miR-8485	HITS-CLIP	23824327
MIRT528928	hsa-miR-8485	HITS-CLIP	23824327
MIRT608879	hsa-miR-511-3p	HITS-CLIP	24906430
MIRT608877	hsa-miR-6867-5p	HITS-CLIP	24906430
MIRT608878	hsa-miR-8068	HITS-CLIP	24906430
MIRT608876	hsa-miR-6818-5p	HITS-CLIP	24906430
MIRT608875	hsa-miR-147a	HITS-CLIP	24906430
MIRT608874	hsa-miR-5010-3p	HITS-CLIP	24906430
MIRT608873	hsa-miR-4455	HITS-CLIP	24906430
MIRT608872	hsa-miR-574-5p	HITS-CLIP	24906430
MIRT528928	hsa-miR-8485	HITS-CLIP	24906430
MIRT528928	hsa-miR-8485	HITS-CLIP	24906430
MIRT528928	hsa-miR-8485	PAR-CLIP	22012620
MIRT528927	hsa-miR-377-3p	PAR-CLIP	22012620
MIRT608875	hsa-miR-147a	HITS-CLIP	27418678
MIRT608875	hsa-miR-147a	HITS-CLIP	27418678
MIRT528927	hsa-miR-377-3p	HITS-CLIP	27418678
MIRT528927	hsa-miR-377-3p	HITS-CLIP	27418678
MIRT528927	hsa-miR-377-3p	HITS-CLIP	27418678
MIRT608873	hsa-miR-4455	HITS-CLIP	27418678
MIRT608873	hsa-miR-4455	HITS-CLIP	27418678
MIRT608874	hsa-miR-5010-3p	HITS-CLIP	27418678
MIRT608874	hsa-miR-5010-3p	HITS-CLIP	27418678
MIRT608872	hsa-miR-574-5p	HITS-CLIP	27418678
MIRT608872	hsa-miR-574-5p	HITS-CLIP	27418678
MIRT608876	hsa-miR-6818-5p	HITS-CLIP	27418678
MIRT608876	hsa-miR-6818-5p	HITS-CLIP	27418678
MIRT608877	hsa-miR-6867-5p	HITS-CLIP	27418678
MIRT608877	hsa-miR-6867-5p	HITS-CLIP	27418678
MIRT608878	hsa-miR-8068	HITS-CLIP	27418678
MIRT608878	hsa-miR-8068	HITS-CLIP	27418678
MIRT528928	hsa-miR-8485	HITS-CLIP	27418678
MIRT528928	hsa-miR-8485	HITS-CLIP	27418678
MIRT528928	hsa-miR-8485	HITS-CLIP	27418678
MIRT528928	hsa-miR-8485	HITS-CLIP	27418678
MIRT528928	hsa-miR-8485	HITS-CLIP	27418678
MIRT528928	hsa-miR-8485	HITS-CLIP	27418678
MIRT733687	hsa-let-7a-5p	ELISA, Luciferase reporter assay, qRT-PCR, Western blotting	31925656
MIRT608879	hsa-miR-511-3p	HITS-CLIP	21572407
MIRT608877	hsa-miR-6867-5p	HITS-CLIP	21572407
MIRT608878	hsa-miR-8068	HITS-CLIP	21572407
MIRT608876	hsa-miR-6818-5p	HITS-CLIP	21572407
MIRT608875	hsa-miR-147a	HITS-CLIP	21572407
MIRT608874	hsa-miR-5010-3p	HITS-CLIP	21572407
MIRT608873	hsa-miR-4455	HITS-CLIP	21572407
MIRT608872	hsa-miR-574-5p	HITS-CLIP	21572407
MIRT528928	hsa-miR-8485	HITS-CLIP	23313552
MIRT528928	hsa-miR-8485	HITS-CLIP	23313552
MIRT528928	hsa-miR-8485	HITS-CLIP	23824327
MIRT528928	hsa-miR-8485	HITS-CLIP	23824327
MIRT528927	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT528928	hsa-miR-8485	HITS-CLIP	23824327
MIRT528928	hsa-miR-8485	HITS-CLIP	23824327
MIRT528928	hsa-miR-8485	HITS-CLIP	23824327
MIRT528928	hsa-miR-8485	HITS-CLIP	23824327
MIRT528928	hsa-miR-8485	HITS-CLIP	23824327
MIRT528928	hsa-miR-8485	HITS-CLIP	23824327
MIRT528928	hsa-miR-8485	HITS-CLIP	23824327
MIRT608879	hsa-miR-511-3p	HITS-CLIP	23824327
MIRT608877	hsa-miR-6867-5p	HITS-CLIP	23824327
MIRT608878	hsa-miR-8068	HITS-CLIP	23824327
MIRT608876	hsa-miR-6818-5p	HITS-CLIP	23824327
MIRT608875	hsa-miR-147a	HITS-CLIP	23824327
MIRT608874	hsa-miR-5010-3p	HITS-CLIP	23824327
MIRT608873	hsa-miR-4455	HITS-CLIP	23824327
MIRT608872	hsa-miR-574-5p	HITS-CLIP	23824327
MIRT528928	hsa-miR-8485	HITS-CLIP	23824327
MIRT528928	hsa-miR-8485	HITS-CLIP	23824327
MIRT528928	hsa-miR-8485	HITS-CLIP	23824327
MIRT528928	hsa-miR-8485	HITS-CLIP	23824327
MIRT528928	hsa-miR-8485	HITS-CLIP	23824327
MIRT528928	hsa-miR-8485	HITS-CLIP	23824327
MIRT528928	hsa-miR-8485	PAR-CLIP	22012620
MIRT528927	hsa-miR-377-3p	PAR-CLIP	22012620
MIRT901519	hsa-miR-216b	CLIP-seq
MIRT901520	hsa-miR-34c-3p	CLIP-seq
MIRT901521	hsa-miR-3609	CLIP-seq
MIRT901522	hsa-miR-4677-3p	CLIP-seq
MIRT901523	hsa-miR-4679	CLIP-seq
MIRT901524	hsa-miR-4711-5p	CLIP-seq
MIRT901525	hsa-miR-4762-5p	CLIP-seq
MIRT901526	hsa-miR-4763-5p	CLIP-seq
MIRT901527	hsa-miR-548ah	CLIP-seq
MIRT901528	hsa-miR-548n	CLIP-seq
MIRT901529	hsa-miR-548t	CLIP-seq
MIRT1967445	hsa-miR-2115	CLIP-seq
MIRT1967446	hsa-miR-4694-3p	CLIP-seq
MIRT1967447	hsa-miR-4698	CLIP-seq
MIRT2506140	hsa-miR-1178	CLIP-seq
MIRT2506141	hsa-miR-3200-3p	CLIP-seq
MIRT2506142	hsa-miR-3591-3p	CLIP-seq
MIRT2506143	hsa-miR-4457	CLIP-seq
MIRT2506144	hsa-miR-513b	CLIP-seq
MIRT2506145	hsa-miR-624	CLIP-seq
MIRT2506140	hsa-miR-1178	CLIP-seq
MIRT2506141	hsa-miR-3200-3p	CLIP-seq
MIRT2506142	hsa-miR-3591-3p	CLIP-seq
MIRT2506143	hsa-miR-4457	CLIP-seq
MIRT2506144	hsa-miR-513b	CLIP-seq
MIRT2506145	hsa-miR-624	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005125	Function	Cytokine activity	IBA
GO:0005127	Function	Ciliary neurotrophic factor receptor binding	IBA
GO:0005127	Function	Ciliary neurotrophic factor receptor binding	IEA
GO:0005127	Function	Ciliary neurotrophic factor receptor binding	TAS	1714745
GO:0005138	Function	Interleukin-6 receptor binding	IPI	12643274
GO:0005515	Function	Protein binding	IPI	16051226, 18775332, 20584990, 25416956, 32296183, 32814053
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IC	12643274
GO:0005615	Component	Extracellular space	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0007165	Process	Signal transduction	NAS	1840538
GO:0007259	Process	Cell surface receptor signaling pathway via JAK-STAT	IBA
GO:0007399	Process	Nervous system development	IEA
GO:0008083	Function	Growth factor activity	IBA
GO:0008083	Function	Growth factor activity	IDA	12643274
GO:0008083	Function	Growth factor activity	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0010628	Process	Positive regulation of gene expression	IDA	24129709
GO:0030154	Process	Cell differentiation	IEA
GO:0030424	Component	Axon	IBA
GO:0042531	Process	Positive regulation of tyrosine phosphorylation of STAT protein	IDA	21912637
GO:0043025	Component	Neuronal cell body	IBA
GO:0043067	Process	Regulation of programmed cell death	IEA
GO:0043524	Process	Negative regulation of neuron apoptotic process	IBA
GO:0043524	Process	Negative regulation of neuron apoptotic process	IDA	10966616
GO:0043524	Process	Negative regulation of neuron apoptotic process	IEA
GO:0044877	Function	Protein-containing complex binding	IPI	10966616
GO:0046533	Process	Negative regulation of photoreceptor cell differentiation	IEA
GO:0046668	Process	Regulation of retinal cell programmed cell death	IEA
GO:0048143	Process	Astrocyte activation	IBA
GO:0048644	Process	Muscle organ morphogenesis	IEA
GO:0048666	Process	Neuron development	IEA
GO:0048680	Process	Positive regulation of axon regeneration	IBA
GO:0060221	Process	Retinal rod cell differentiation	IEA
GO:0070120	Process	Ciliary neurotrophic factor-mediated signaling pathway	IBA
GO:0070120	Process	Ciliary neurotrophic factor-mediated signaling pathway	IDA	12643274
GO:0070120	Process	Ciliary neurotrophic factor-mediated signaling pathway	IEA
GO:0097386	Component	Glial cell projection	IBA
GO:0097696	Process	Cell surface receptor signaling pathway via STAT	IDA	12643274

Other IDs

• MIM: 118945
• HGNC: 2169
• e!Ensembl: ENSG00000242689

Protein

• UniProt ID: P26441
• Protein name: Ciliary neurotrophic factor (CNTF)
• Protein function: CNTF is a survival factor for various neuronal cell types. Seems to prevent the degeneration of motor axons after axotomy.
• PDB: 1CNT, 8D74
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01110	CNTF	1 → 194	Ciliary neurotrophic factor	Domain

• Tissue specificity: TISSUE SPECIFICITY: Nervous system.
• Sequence:

  MAFTEHSPLTPHRRDLCSRSIWLARKIRSDLTALTESYVKHQGLNKNINLDSADGMPVAS
  TDQWSELTEAERLQENLQAYRTFHVLLARLLEDQQVHFTPTEGDFHQAIHTLLLQVAAFA
  YQIEELMILLEYKIPRNEADGMPINVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRFIS
  SHQTGIPARGSHYIANNKKM

• Sequence length: 200

Pathways

KEGG:

Cytokine-cytokine receptor interaction
JAK-STAT signaling pathway

Reactome:

IL-6-type cytokine receptor ligand interactions

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
AMYOTROPHIC LATERAL SCLEROSIS 1	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CEREBRAL HEMORRHAGE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CILIARY NEUROTROPHIC FACTOR POLYMORPHISM	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLAUCOMA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HUNTINGTON DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOTOR NEURON DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Achromatopsia	Achromatopsia	BEFREE	23568263, 26196097		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	11095488		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	24191003		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Early Onset	Alzheimer disease	BEFREE	28368015		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	10529543, 11038064, 12838531, 17651970, 25896245, 8244400, 8543936, 8640564, 8764576, 8860837		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	LHGDN	11951178		★☆☆☆☆ Found in Text Mining only
AMYOTROPHIC LATERAL SCLEROSIS 1	Lateral Sclerosis	BEFREE	11951178		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AMYOTROPHIC LATERAL SCLEROSIS 1	Lateral Sclerosis	CTD_human_DG	11951178		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Amyotrophic Lateral Sclerosis, Familial	Amyotrophic lateral sclerosis	BEFREE	11951178, 8543936		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis, Familial	Amyotrophic lateral sclerosis	CTD_human_DG	11951178		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis, Sporadic	Lateral Sclerosis	BEFREE	11951178		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis, Sporadic	Lateral Sclerosis	CTD_human_DG	11951178		★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	23568263		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	30299260		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	30299260		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	10720204, 30299260		★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	29869578		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	25769033		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	28765641		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	28765641	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	34477239	Associate	★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	BEFREE	29225456		★☆☆☆☆ Found in Text Mining only
Charcot-Marie-Tooth Disease	Charcot-Marie-Tooth Disease	BEFREE	17651970, 19525893		★☆☆☆☆ Found in Text Mining only
Charcot-Marie-Tooth Disease, Type Ia (disorder)	Charcot-Marie-Tooth disease	BEFREE	19525893		★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	BEFREE	16475952		★☆☆☆☆ Found in Text Mining only
COLD-INDUCED SWEATING SYNDROME 1	Cold-Induced Sweating Syndrome	BEFREE	27054527		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	25117815	Associate	★☆☆☆☆ Found in Text Mining only
Cyst	Cyst	BEFREE	30245710		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	PSYGENET_DG	15585112, 16797081, 18603262, 22266927		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	BEFREE	16797081, 30299260		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes	Diabetes	BEFREE	29795129, 9177239		★☆☆☆☆ Found in Text Mining only
Diabetes Complications	Diabetes complications	Pubtator	25394427	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	23371458, 29795129, 9177239		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	31554967		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	28656312		★☆☆☆☆ Found in Text Mining only
Eating Disorders	Eating Disorders	BEFREE	20219210		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	27973757, 28177690		★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	29225456		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glaucoma, Primary Open Angle	Glaucoma	BEFREE	29225456		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	10720204, 18167341		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	18167341		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	28765641	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	9760066		★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	BEFREE	28368015		★☆☆☆☆ Found in Text Mining only
Glycogen storage disease type II	Glycogen Storage Disease	BEFREE	24191003		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	10812968, 10834619, 10954906, 12427308, 14697316, 15585112, 16475952, 18293418, 9121555, 9171158, 9305364, 9588602		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Huntington Disease	Huntington Disease	LHGDN	18293418		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Impaired cognition	Impaired Cognition	BEFREE	20519526, 9171158		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	33069917	Associate	★☆☆☆☆ Found in Text Mining only
Insulin-Like Growth Factor I Deficiency	Insulin-Like Growth Factor I Deficiency	BEFREE	30708048		★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	29869578		★☆☆☆☆ Found in Text Mining only
Keratitis	Keratitis	BEFREE	27054527		★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	BEFREE	23489213		★☆☆☆☆ Found in Text Mining only
LEPTIN DEFICIENCY OR DYSFUNCTION	LEPTIN DEFICIENCY OR DYSFUNCTION	BEFREE	9177239		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	LHGDN	14715713		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	31624329		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	7687632		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	7687632		★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	30564974		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	PSYGENET_DG	15585112, 16797081, 18603262, 22266927		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	BEFREE	16797081, 30299260		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Metabolic Diseases	Metabolic Diseases	BEFREE	26187860, 28711730		★☆☆☆☆ Found in Text Mining only
Motor neuron atrophy	Motor neuron atrophy	BEFREE	10812968, 9342199		★☆☆☆☆ Found in Text Mining only
Motor Neuron Disease	Motor Neuron Disease	BEFREE	12645079, 19457136, 9466600		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Myeloma	Multiple myeloma	Pubtator	8145045	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	11857064, 11890844, 17898009, 20558237, 23653362, 26187860, 26399250		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple Sclerosis	LHGDN	11857064, 11890844		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neoplasms	Neoplasms	BEFREE	10720204, 11375124, 11494026		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	10660304, 9459616, 9523557	Associate	★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	7760021, 9523557		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	24802752, 25118897, 25394427, 7796798	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	LHGDN	17651970		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	19457136, 24486790, 25896245, 30423807, 8543936, 8934227		★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	11360269, 19525893		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	16210701, 17404609, 9177239, 9628240		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	16210701, 25394427	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	BEFREE	30423807		★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	BEFREE	11358282		★☆☆☆☆ Found in Text Mining only
PIGMENTARY DISORDER, RETICULATE, WITH SYSTEMIC MANIFESTATIONS	Pigmentary Disorder, Reticulate, With Systemic Manifestations	BEFREE	29084332		★☆☆☆☆ Found in Text Mining only
Proliferative diabetic retinopathy	Proliferative Diabetic Retinopathy	BEFREE	29084332		★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	9601653		★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychotic disorders	Pubtator	9790747	Associate	★☆☆☆☆ Found in Text Mining only
Pterygium	Pterygium	BEFREE	18585018		★☆☆☆☆ Found in Text Mining only
Retinal Degeneration	Retinal degeneration	Pubtator	16505355	Associate	★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	12935781, 27494343, 28589680		★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa	Retinitis Pigmentosa	BEFREE	11237681, 16475952, 24191003, 25896245		★☆☆☆☆ Found in Text Mining only
Retinopathy of Prematurity	Retinopathy	BEFREE	28589680		★☆☆☆☆ Found in Text Mining only
Schizoaffective Disorder	Schizoaffective Disorder	BEFREE	9601653		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	11343865, 15474906, 16969278, 18303965, 8856688, 9247976, 9285965, 9342199, 9601653		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	11343865, 15474906, 16969278, 18303965		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	LHGDN	18303965		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Steatohepatitis	Fatty Liver	BEFREE	27973757, 28177690		★☆☆☆☆ Found in Text Mining only