CNR2 (cannabinoid receptor 2)

Gene

• Entrez ID: 1269
• Gene name: Cannabinoid receptor 2
• Gene symbol: CNR2
• Synonyms (NCBI Gene): CB-2, CB2, CX5
• Chromosome: 1
• Chromosome location: 1p36.11
• Summary: The cannabinoid delta-9-tetrahydrocannabinol is the principal psychoactive ingredient of marijuana. The proteins encoded by this gene and the cannabinoid receptor 1 (brain) (CNR1) gene have the characteristics of a guanine nucleotide-binding protein (G-pr

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT438440	hsa-miR-665	Luciferase reporter assay, Western blot	25111814
MIRT438440	hsa-miR-665	Luciferase reporter assay, Western blot	25111814
MIRT438440	hsa-miR-665	Luciferase reporter assay, Western blot	25111814
MIRT438440	hsa-miR-665	Luciferase reporter assay, Western blot	25111814
MIRT438440	hsa-miR-665	Luciferase reporter assay, Western blot	25111814
MIRT438440	hsa-miR-665	Luciferase reporter assay, Western blot	25111814
MIRT438440	hsa-miR-665	Luciferase reporter assay, Western blot	25111814
MIRT438440	hsa-miR-665	Luciferase reporter assay, Western blot	25111814
MIRT438440	hsa-miR-665	Luciferase reporter assay, Western blot	25111814
MIRT438440	hsa-miR-665	Luciferase reporter assay, Western blot	25111814
MIRT438440	hsa-miR-665	Luciferase reporter assay, Western blot	25111814
MIRT438440	hsa-miR-665	Luciferase reporter assay, Western blot	25111814
MIRT438440	hsa-miR-665	Luciferase reporter assay, Western blot	25111814
MIRT438440	hsa-miR-665	Luciferase reporter assay, Western blot	25111814
MIRT438440	hsa-miR-665	Luciferase reporter assay, Western blot	25111814
MIRT438440	hsa-miR-665	Luciferase reporter assay, Western blot	25111814
MIRT438440	hsa-miR-665	Luciferase reporter assay, Western blot	25111814
MIRT438440	hsa-miR-665	Luciferase reporter assay, Western blot	25111814
MIRT438440	hsa-miR-665	Luciferase reporter assay, Western blot	25111814
MIRT438440	hsa-miR-665	Luciferase reporter assay, Western blot	25111814
MIRT438440	hsa-miR-665	Luciferase reporter assay, Western blot	25111814
MIRT438440	hsa-miR-665	Luciferase reporter assay, Western blot	25111814
MIRT438440	hsa-miR-665	Luciferase reporter assay, Western blot	25111814
MIRT438440	hsa-miR-665	Luciferase reporter assay, Western blot	25111814
MIRT438440	hsa-miR-665	Luciferase reporter assay, Western blot	25111814
MIRT438440	hsa-miR-665	Luciferase reporter assay, Western blot	25111814
MIRT438440	hsa-miR-665	Luciferase reporter assay, Western blot	25111814
MIRT438440	hsa-miR-665	Luciferase reporter assay, Western blot	25111814
MIRT901403	hsa-miR-1253	CLIP-seq
MIRT901404	hsa-miR-2964a-5p	CLIP-seq
MIRT901405	hsa-miR-3661	CLIP-seq
MIRT901406	hsa-miR-4764-5p	CLIP-seq
MIRT901407	hsa-miR-619	CLIP-seq
MIRT901408	hsa-miR-631	CLIP-seq
MIRT2447350	hsa-miR-1245b-5p	CLIP-seq
MIRT2447351	hsa-miR-3142	CLIP-seq
MIRT2447352	hsa-miR-3173-3p	CLIP-seq
MIRT2447353	hsa-miR-4695-5p	CLIP-seq
MIRT2447354	hsa-miR-520a-5p	CLIP-seq
MIRT2447355	hsa-miR-525-5p	CLIP-seq
MIRT2447350	hsa-miR-1245b-5p	CLIP-seq
MIRT2447351	hsa-miR-3142	CLIP-seq
MIRT2447352	hsa-miR-3173-3p	CLIP-seq
MIRT2447353	hsa-miR-4695-5p	CLIP-seq
MIRT2447354	hsa-miR-520a-5p	CLIP-seq
MIRT2447355	hsa-miR-525-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001975	Process	Response to amphetamine	IEA
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004949	Function	Cannabinoid receptor activity	IBA
GO:0004949	Function	Cannabinoid receptor activity	IEA
GO:0004949	Function	Cannabinoid receptor activity	TAS	8679694
GO:0005515	Function	Protein binding	IPI	31616248, 32296183
GO:0005737	Component	Cytoplasm	IBA
GO:0005783	Component	Endoplasmic reticulum	IDA	28364261
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	8679694
GO:0006954	Process	Inflammatory response	IEA
GO:0006955	Process	Immune response	TAS	7556170
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007187	Process	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger	IEA
GO:0007187	Process	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger	TAS	8679694
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IBA
GO:0016020	Component	Membrane	IEA
GO:0030425	Component	Dendrite	IEA
GO:0030595	Process	Leukocyte chemotaxis	IEA
GO:0031234	Component	Extrinsic component of cytoplasmic side of plasma membrane	IEA
GO:0032229	Process	Negative regulation of synaptic transmission, GABAergic	IEA
GO:0032496	Process	Response to lipopolysaccharide	IEA
GO:0033004	Process	Negative regulation of mast cell activation	IEA
GO:0038171	Process	Cannabinoid signaling pathway	IEA
GO:0042995	Component	Cell projection	IEA
GO:0043025	Component	Neuronal cell body	IEA
GO:0043204	Component	Perikaryon	IEA
GO:0045211	Component	Postsynaptic membrane	IEA
GO:0045759	Process	Negative regulation of action potential	IEA
GO:0099553	Process	Trans-synaptic signaling by endocannabinoid, modulating synaptic transmission	IEA

Other IDs

• MIM: 605051
• HGNC: 2160
• e!Ensembl: ENSG00000188822

Protein

• UniProt ID: P34972
• Protein name: Cannabinoid receptor 2 (CB-2) (CB2) (hCB2) (CX5)
• Protein function: Heterotrimeric G protein-coupled receptor for endocannabinoid 2-arachidonoylglycerol mediating inhibition of adenylate cyclase. May function in inflammatory response, nociceptive transmission and bone homeostasis. {ECO:0000269|PubMed:10051546, E
• PDB: 2KI9, 5ZTY, 6KPC, 6KPF, 6PT0, 8GUQ, 8GUR, 8GUS, 8GUT, 8X3L
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	50 → 299	7 transmembrane receptor (rhodopsin family)	Family

• Tissue specificity: TISSUE SPECIFICITY: Preferentially expressed in cells of the immune system with higher expression in B-cells and NK cells (at protein level). Expressed in skin in suprabasal layers and hair follicles (at protein level). Highly expressed in tonsil and to a
• Sequence:

  MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILS
  SHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTAS
  VGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCS
  ELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLD
  VRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYA
  LRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC
  

• Sequence length: 360

Pathways

KEGG:

Neuroactive ligand-receptor interaction

Reactome:

Class A/1 (Rhodopsin-like receptors)
G alpha (i) signalling events

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ANTERIOR CRUCIATE LIGAMENT INJURIES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATHEROSCLEROSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CANNABIS USE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CATALEPSY	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHOLESTASIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIARRHEA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DISORDERS INVOLVING THE IMMUNE MECHANISM	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DYSENTERY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIAL NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERALGESIA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPEREMIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERGLYCEMIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IMMUNE SYSTEM DISEASES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKEMIA, MYELOID, ACUTE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANCREATIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANCREATITIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE, SECONDARY	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POST-TRAUMATIC STRESS DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCLERODERMA, SYSTEMIC	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SECONDARY PARKINSON DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC SCLERODERMA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations