Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	126755
Gene name	Leucine rich repeat containing 38
Gene symbol	LRRC38
Synonyms (NCBI Gene)	-
Chromosome	1
Chromosome location	1p36.21

Show/Hide all (73)

miRTarBase ID	miRNA	Experiments	Reference
MIRT528149	hsa-miR-8485	PAR-CLIP	22012620
MIRT528148	hsa-miR-329-3p	PAR-CLIP	22012620
MIRT528147	hsa-miR-362-3p	PAR-CLIP	22012620
MIRT528146	hsa-miR-1228-3p	PAR-CLIP	22012620
MIRT528145	hsa-miR-6793-3p	PAR-CLIP	22012620
MIRT528144	hsa-miR-361-3p	PAR-CLIP	22012620
MIRT528143	hsa-miR-942-5p	PAR-CLIP	22012620
MIRT528142	hsa-miR-4713-5p	PAR-CLIP	22012620
MIRT528141	hsa-miR-6867-3p	PAR-CLIP	22012620
MIRT528140	hsa-miR-629-3p	PAR-CLIP	22012620
MIRT528149	hsa-miR-8485	PAR-CLIP	22012620
MIRT528148	hsa-miR-329-3p	PAR-CLIP	22012620
MIRT528147	hsa-miR-362-3p	PAR-CLIP	22012620
MIRT528146	hsa-miR-1228-3p	PAR-CLIP	22012620
MIRT528145	hsa-miR-6793-3p	PAR-CLIP	22012620
MIRT528144	hsa-miR-361-3p	PAR-CLIP	22012620
MIRT528143	hsa-miR-942-5p	PAR-CLIP	22012620
MIRT528142	hsa-miR-4713-5p	PAR-CLIP	22012620
MIRT528141	hsa-miR-6867-3p	PAR-CLIP	22012620
MIRT528140	hsa-miR-629-3p	PAR-CLIP	22012620
MIRT1119580	hsa-miR-1912	CLIP-seq
MIRT1119581	hsa-miR-1915	CLIP-seq
MIRT1119582	hsa-miR-214	CLIP-seq
MIRT1119583	hsa-miR-3130-5p	CLIP-seq
MIRT1119584	hsa-miR-3616-3p	CLIP-seq
MIRT1119585	hsa-miR-3619-5p	CLIP-seq
MIRT1119586	hsa-miR-3665	CLIP-seq
MIRT1119587	hsa-miR-3934	CLIP-seq
MIRT1119588	hsa-miR-433	CLIP-seq
MIRT1119589	hsa-miR-4482	CLIP-seq
MIRT1119590	hsa-miR-4530	CLIP-seq
MIRT1119591	hsa-miR-4721	CLIP-seq
MIRT1119592	hsa-miR-761	CLIP-seq
MIRT1550935	hsa-miR-3612	CLIP-seq
MIRT1550936	hsa-miR-3652	CLIP-seq
MIRT1550937	hsa-miR-4251	CLIP-seq
MIRT1550938	hsa-miR-4329	CLIP-seq
MIRT1550939	hsa-miR-4430	CLIP-seq
MIRT1550940	hsa-miR-4443	CLIP-seq
MIRT1550941	hsa-miR-485-5p	CLIP-seq
MIRT1550942	hsa-miR-650	CLIP-seq
MIRT2033785	hsa-miR-1224-3p	CLIP-seq
MIRT2033786	hsa-miR-23a	CLIP-seq
MIRT2033787	hsa-miR-23b	CLIP-seq
MIRT2033788	hsa-miR-23c	CLIP-seq
MIRT1550936	hsa-miR-3652	CLIP-seq
MIRT2033789	hsa-miR-3973	CLIP-seq
MIRT2033790	hsa-miR-4277	CLIP-seq
MIRT1550939	hsa-miR-4430	CLIP-seq
MIRT2033791	hsa-miR-4758-3p	CLIP-seq
MIRT2033792	hsa-miR-520g	CLIP-seq
MIRT2033793	hsa-miR-520h	CLIP-seq
MIRT2033794	hsa-miR-578	CLIP-seq
MIRT2033795	hsa-miR-581	CLIP-seq
MIRT2264204	hsa-miR-1299	CLIP-seq
MIRT2264205	hsa-miR-1343	CLIP-seq
MIRT2264206	hsa-miR-150	CLIP-seq
MIRT2264207	hsa-miR-3182	CLIP-seq
MIRT2264208	hsa-miR-3194-3p	CLIP-seq
MIRT1550935	hsa-miR-3612	CLIP-seq
MIRT1550936	hsa-miR-3652	CLIP-seq
MIRT2264209	hsa-miR-3667-3p	CLIP-seq
MIRT2264210	hsa-miR-378g	CLIP-seq
MIRT1550937	hsa-miR-4251	CLIP-seq
MIRT2033790	hsa-miR-4277	CLIP-seq
MIRT1550938	hsa-miR-4329	CLIP-seq
MIRT1550939	hsa-miR-4430	CLIP-seq
MIRT1550940	hsa-miR-4443	CLIP-seq
MIRT2264211	hsa-miR-4782-5p	CLIP-seq
MIRT1550941	hsa-miR-485-5p	CLIP-seq
MIRT2264212	hsa-miR-516b	CLIP-seq
MIRT2264213	hsa-miR-532-3p	CLIP-seq
MIRT1550942	hsa-miR-650	CLIP-seq

Show/Hide all (18)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005249	Function	Voltage-gated potassium channel activity	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	ISS	22547800
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0008076	Component	Voltage-gated potassium channel complex	IBA
GO:0008076	Component	Voltage-gated potassium channel complex	IDA	22547800
GO:0008076	Component	Voltage-gated potassium channel complex	IEA
GO:0016020	Component	Membrane	IEA
GO:0034220	Process	Monoatomic ion transmembrane transport	IEA
GO:0044325	Function	Transmembrane transporter binding	IBA
GO:0044325	Function	Transmembrane transporter binding	IEA
GO:0044325	Function	Transmembrane transporter binding	IPI	22547800
GO:0071805	Process	Potassium ion transmembrane transport	IDA	22547800
GO:0071805	Process	Potassium ion transmembrane transport	IEA
GO:0099104	Function	Potassium channel activator activity	IBA
GO:0099104	Function	Potassium channel activator activity	IDA	22547800
GO:0099104	Function	Potassium channel activator activity	IEA
GO:1903818	Process	Positive regulation of voltage-gated potassium channel activity	IDA	22547800

MIM	HGNC	e!Ensembl
615212	27005	ENSG00000162494

Q5VT99

Protein name

Leucine-rich repeat-containing protein 38 (BK channel auxiliary gamma subunit LRRC38)

Protein function

Auxiliary protein of the large-conductance, voltage and calcium-activated potassium channel (BK alpha). Modulates gating properties by producing a marked shift in the BK channel's voltage dependence of activation in the hyperpolarizing direction

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00560	LRR_1	105 → 126	Leucine Rich Repeat	Repeat
PF13855	LRR_8	128 → 187	Leucine rich repeat	Repeat

Tissue specificity

TISSUE SPECIFICITY: Mainly expressed in adrenal gland, thymus and skeletal muscle. {ECO:0000269|PubMed:22547800}.

Sequence

MRPRAPACAAAALGLCSLLLLLAPGHACPAGCACTDPHTVDCRDRGLPSVPDPFPLDVRK
LLVAGNRIQRIPEDFFIFYGDLVYLDFRNNSLRSLEEGTFSGSAKLVFLDLSYNNLTQLG
AGAFRSAGRLVKLSLANNNLVGVHEDAFETLESLQVLELNDNNLRSLSVAALAALPALRS
LRLDGNPWLCDCDFAHLFSWIQENASKLPKGLDEIQCSLPMESRRISLRELSEASFSECR
FSLSLTDLCIIIFSGVAVSIAAIISSFFLATVVQCLQRCAPNKDAEDEDEDKDD

Sequence length

294

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UPPER AERODIGESTIVE TRACT NEOPLASM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

LRRC38 (leucine rich repeat containing 38)