HSPB6 (heat shock protein family B (small) member 6)

Gene

• Entrez ID: 126393
• Gene name: Heat shock protein family B (small) member 6
• Gene symbol: HSPB6
• Synonyms (NCBI Gene): HEL55, Hsp20, PPP1R91
• Chromosome: 19
• Chromosome location: 19q13.12
• Summary: This locus encodes a heat shock protein. The encoded protein likely plays a role in smooth muscle relaxation. [provided by RefSeq, Jan 2012]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT004508	hsa-miR-320a	Luciferase reporter assay	19380620
MIRT572330	hsa-miR-6783-5p	PAR-CLIP	20371350
MIRT572329	hsa-miR-29b-1-5p	PAR-CLIP	20371350
MIRT572328	hsa-miR-3120-5p	PAR-CLIP	20371350
MIRT572327	hsa-miR-6132	PAR-CLIP	20371350
MIRT572326	hsa-miR-6836-5p	PAR-CLIP	20371350
MIRT572325	hsa-miR-1909-3p	PAR-CLIP	20371350
MIRT572324	hsa-miR-6722-3p	PAR-CLIP	20371350
MIRT572323	hsa-miR-4533	PAR-CLIP	20371350
MIRT572322	hsa-miR-4747-5p	PAR-CLIP	20371350
MIRT572320	hsa-miR-5196-5p	PAR-CLIP	20371350
MIRT572321	hsa-miR-4271	PAR-CLIP	20371350
MIRT572319	hsa-miR-4725-3p	PAR-CLIP	20371350
MIRT572318	hsa-miR-6780b-5p	PAR-CLIP	20371350
MIRT572317	hsa-miR-656-5p	PAR-CLIP	20371350
MIRT572316	hsa-miR-6511b-5p	PAR-CLIP	20371350
MIRT572315	hsa-miR-6811-5p	PAR-CLIP	20371350
MIRT572314	hsa-miR-1231	PAR-CLIP	20371350
MIRT572330	hsa-miR-6783-5p	PAR-CLIP	20371350
MIRT572329	hsa-miR-29b-1-5p	PAR-CLIP	20371350
MIRT572328	hsa-miR-3120-5p	PAR-CLIP	20371350
MIRT572327	hsa-miR-6132	PAR-CLIP	20371350
MIRT572326	hsa-miR-6836-5p	PAR-CLIP	20371350
MIRT572325	hsa-miR-1909-3p	PAR-CLIP	20371350
MIRT572324	hsa-miR-6722-3p	PAR-CLIP	20371350
MIRT572323	hsa-miR-4533	PAR-CLIP	20371350
MIRT572322	hsa-miR-4747-5p	PAR-CLIP	20371350
MIRT572320	hsa-miR-5196-5p	PAR-CLIP	20371350
MIRT572321	hsa-miR-4271	PAR-CLIP	20371350
MIRT572319	hsa-miR-4725-3p	PAR-CLIP	20371350
MIRT572318	hsa-miR-6780b-5p	PAR-CLIP	20371350
MIRT572317	hsa-miR-656-5p	PAR-CLIP	20371350
MIRT572316	hsa-miR-6511b-5p	PAR-CLIP	20371350
MIRT572315	hsa-miR-6811-5p	PAR-CLIP	20371350
MIRT572314	hsa-miR-1231	PAR-CLIP	20371350
MIRT1056406	hsa-miR-1252	CLIP-seq
MIRT1056407	hsa-miR-1253	CLIP-seq
MIRT1056408	hsa-miR-1587	CLIP-seq
MIRT1056409	hsa-miR-3135b	CLIP-seq
MIRT1056410	hsa-miR-3652	CLIP-seq
MIRT1056411	hsa-miR-3689a-3p	CLIP-seq
MIRT1056412	hsa-miR-3689c	CLIP-seq
MIRT1056413	hsa-miR-3689d	CLIP-seq
MIRT1056414	hsa-miR-3940-5p	CLIP-seq
MIRT1056415	hsa-miR-4428	CLIP-seq
MIRT1056416	hsa-miR-4430	CLIP-seq
MIRT1056417	hsa-miR-4434	CLIP-seq
MIRT1056418	hsa-miR-4492	CLIP-seq
MIRT1056419	hsa-miR-4498	CLIP-seq
MIRT1056420	hsa-miR-4507	CLIP-seq
MIRT1056421	hsa-miR-4516	CLIP-seq
MIRT1056422	hsa-miR-4656	CLIP-seq
MIRT1056423	hsa-miR-4675	CLIP-seq
MIRT1056424	hsa-miR-4728-5p	CLIP-seq
MIRT1056425	hsa-miR-4741	CLIP-seq
MIRT1056426	hsa-miR-4779	CLIP-seq
MIRT1056427	hsa-miR-486-3p	CLIP-seq
MIRT1056428	hsa-miR-762	CLIP-seq
MIRT1056429	hsa-miR-765	CLIP-seq
MIRT1549651	hsa-miR-3126-3p	CLIP-seq
MIRT1056424	hsa-miR-4728-5p	CLIP-seq
MIRT2012966	hsa-miR-1909	CLIP-seq
MIRT2012967	hsa-miR-4481	CLIP-seq
MIRT2012968	hsa-miR-4745-5p	CLIP-seq
MIRT2012966	hsa-miR-1909	CLIP-seq
MIRT1056410	hsa-miR-3652	CLIP-seq
MIRT1056416	hsa-miR-4430	CLIP-seq
MIRT2451438	hsa-miR-1275	CLIP-seq
MIRT2451439	hsa-miR-193a-3p	CLIP-seq
MIRT2451440	hsa-miR-193b	CLIP-seq
MIRT2451441	hsa-miR-3170	CLIP-seq
MIRT2451442	hsa-miR-3176	CLIP-seq
MIRT2451443	hsa-miR-3922-3p	CLIP-seq
MIRT2451444	hsa-miR-4525	CLIP-seq
MIRT2451445	hsa-miR-4665-5p	CLIP-seq
MIRT2451446	hsa-miR-4723-5p	CLIP-seq
MIRT1056424	hsa-miR-4728-5p	CLIP-seq
MIRT2451447	hsa-miR-625	CLIP-seq
MIRT2451448	hsa-miR-661	CLIP-seq
MIRT2548406	hsa-miR-2467-5p	CLIP-seq
MIRT2548407	hsa-miR-3150b-3p	CLIP-seq
MIRT2548408	hsa-miR-342-5p	CLIP-seq
MIRT2548409	hsa-miR-4293	CLIP-seq
MIRT2548410	hsa-miR-4466	CLIP-seq
MIRT2548411	hsa-miR-4532	CLIP-seq
MIRT2548412	hsa-miR-4664-5p	CLIP-seq
MIRT2548413	hsa-miR-4689	CLIP-seq
MIRT2548414	hsa-miR-4695-5p	CLIP-seq
MIRT2548415	hsa-miR-4784	CLIP-seq
MIRT2548416	hsa-miR-544b	CLIP-seq
MIRT2548417	hsa-miR-675	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005212	Function	Structural constituent of eye lens	IEA
GO:0005576	Component	Extracellular region	IDA	22427880
GO:0005576	Component	Extracellular region	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	19464326
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	19464326
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IDA
GO:0005829	Component	Cytosol	IDA
GO:0006457	Process	Protein folding	IDA	14717697
GO:0009408	Process	Response to heat	IBA
GO:0010667	Process	Negative regulation of cardiac muscle cell apoptotic process	IEA
GO:0016607	Component	Nuclear speck	IDA
GO:0019901	Function	Protein kinase binding	IEA
GO:0042026	Process	Protein refolding	IBA
GO:0042803	Function	Protein homodimerization activity	IEA
GO:0042803	Function	Protein homodimerization activity	ISS
GO:0043066	Process	Negative regulation of apoptotic process	IBA
GO:0044183	Function	Protein folding chaperone	IDA	24382496
GO:0045766	Process	Positive regulation of angiogenesis	IDA	22427880
GO:0051082	Function	Unfolded protein binding	IBA
GO:0051082	Function	Unfolded protein binding	IDA	19845507
GO:0051087	Function	Protein-folding chaperone binding	IPI	23948568

Other IDs

• MIM: 610695
• HGNC: 26511
• e!Ensembl: ENSG00000004776

Protein

• UniProt ID: O14558
• Protein name: Heat shock protein beta-6 (HspB6) (Heat shock 20 kDa-like protein p20) (Heat shock protein family B member 6)
• Protein function: Small heat shock protein which functions as a molecular chaperone probably maintaining denatured proteins in a folding-competent state. Seems to have versatile functions in various biological processes. Plays a role in regulating muscle function
• PDB: 4JUS, 4JUT, 5LTW, 5LU1, 5LU2, 5LUM, 5OK9, 5OKF
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00525	Crystallin	3 → 62	Alpha crystallin A chain, N terminal	Family
  PF00011	HSP20	66 → 158	Hsp20/alpha crystallin family	Family

• Sequence:

  MEIPVPVQPSWLRRASAPLPGLSAPGRLFDQRFGEGLLEAELAALCPTTLAPYYLRAPSV
  ALPVAQVPTDPGHFSVLLDVKHFSPEEIAVKVVGEHVEVHARHEERPDEHGFVAREFHRR
  YRLPPGVDPAAVTSALSPEGVLSIQAAPASAQAPPPAAAK

• Sequence length: 160

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
EBV-positive nodal T- and NK-cell lymphoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Alzheimer Disease	Alzheimer disease	Pubtator	24859569	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	25187324		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	35132081	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	17487383, 24223153, 27046040, 28456666	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomegaly	Cardiomegaly	Pubtator	38172650	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	29157081, 29761889		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	36918127	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Dilated	Cardiomyopathy	BEFREE	18790732, 29157081		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	29157081		★☆☆☆☆ Found in Text Mining only
Cerebral Amyloid Angiopathy	Cerebral amyloid angiopathy	BEFREE	16635482		★☆☆☆☆ Found in Text Mining only
Chronic Pain	Chronic pain	Pubtator	27832094	Associate	★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	29574629		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	25187324		★☆☆☆☆ Found in Text Mining only
Demyelinating Diseases	Demyelinating diseases	Pubtator	26694816	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	30511325		★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	29301256	Associate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	18790732, 20869365		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Diseases	Heart Diseases	CTD_human_DG	18948619		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Diseases	Heart disease	Pubtator	21545686	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Failure	Heart failure	Pubtator	21545686	Associate	★☆☆☆☆ Found in Text Mining only
Hyperplasia	Hyperplasia	Pubtator	15218470	Inhibit	★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	29574629		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	24223153, 25447820, 27046040, 28456666, 29318189		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	30286088	Associate	★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	25187324		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	26694816	Stimulate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	30014472		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	30014472	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	31210321		★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	19850943		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	24859569		★☆☆☆☆ Found in Text Mining only
Senile Plaques	Senile Plaques	BEFREE	16635482		★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	31273911		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	34930465	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	39372720	Associate	★☆☆☆☆ Found in Text Mining only
Vasospasm Intracranial	Intracranial vasospasm	Pubtator	15829720	Inhibit	★☆☆☆☆ Found in Text Mining only