Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	125893
Gene name	Zinc finger protein 816
Gene symbol	ZNF816
Synonyms (NCBI Gene)	ZNF816A
Chromosome	19
Chromosome location	19q13.41

Show/Hide all (72)

miRTarBase ID	miRNA	Experiments	Reference
MIRT035958	hsa-miR-1301-3p	CLASH	23622248
MIRT1541175	hsa-miR-128	CLIP-seq
MIRT1541176	hsa-miR-1294	CLIP-seq
MIRT1541177	hsa-miR-1976	CLIP-seq
MIRT1541178	hsa-miR-27a	CLIP-seq
MIRT1541179	hsa-miR-27b	CLIP-seq
MIRT1541180	hsa-miR-3064-3p	CLIP-seq
MIRT1541181	hsa-miR-3145-3p	CLIP-seq
MIRT1541182	hsa-miR-3925-3p	CLIP-seq
MIRT1541183	hsa-miR-4282	CLIP-seq
MIRT1541184	hsa-miR-4316	CLIP-seq
MIRT1541185	hsa-miR-433	CLIP-seq
MIRT1541186	hsa-miR-4712-5p	CLIP-seq
MIRT1541187	hsa-miR-4715-3p	CLIP-seq
MIRT1541188	hsa-miR-4729	CLIP-seq
MIRT1541189	hsa-miR-4766-5p	CLIP-seq
MIRT1541190	hsa-miR-4768-5p	CLIP-seq
MIRT1541191	hsa-miR-4776-3p	CLIP-seq
MIRT1541192	hsa-miR-556-3p	CLIP-seq
MIRT1541193	hsa-miR-766	CLIP-seq
MIRT1541194	hsa-miR-770-5p	CLIP-seq
MIRT2163361	hsa-miR-1179	CLIP-seq
MIRT1541176	hsa-miR-1294	CLIP-seq
MIRT1541177	hsa-miR-1976	CLIP-seq
MIRT1541180	hsa-miR-3064-3p	CLIP-seq
MIRT1541181	hsa-miR-3145-3p	CLIP-seq
MIRT2163362	hsa-miR-323b-5p	CLIP-seq
MIRT2163363	hsa-miR-3674	CLIP-seq
MIRT1541182	hsa-miR-3925-3p	CLIP-seq
MIRT1541184	hsa-miR-4316	CLIP-seq
MIRT2163364	hsa-miR-4420	CLIP-seq
MIRT1541186	hsa-miR-4712-5p	CLIP-seq
MIRT1541187	hsa-miR-4715-3p	CLIP-seq
MIRT2163365	hsa-miR-4724-5p	CLIP-seq
MIRT1541188	hsa-miR-4729	CLIP-seq
MIRT1541190	hsa-miR-4768-5p	CLIP-seq
MIRT1541192	hsa-miR-556-3p	CLIP-seq
MIRT2163366	hsa-miR-758	CLIP-seq
MIRT1541193	hsa-miR-766	CLIP-seq
MIRT1541194	hsa-miR-770-5p	CLIP-seq
MIRT1541175	hsa-miR-128	CLIP-seq
MIRT1541176	hsa-miR-1294	CLIP-seq
MIRT1541177	hsa-miR-1976	CLIP-seq
MIRT1541178	hsa-miR-27a	CLIP-seq
MIRT1541179	hsa-miR-27b	CLIP-seq
MIRT1541180	hsa-miR-3064-3p	CLIP-seq
MIRT1541181	hsa-miR-3145-3p	CLIP-seq
MIRT1541182	hsa-miR-3925-3p	CLIP-seq
MIRT1541184	hsa-miR-4316	CLIP-seq
MIRT1541185	hsa-miR-433	CLIP-seq
MIRT2382532	hsa-miR-4452	CLIP-seq
MIRT2382533	hsa-miR-4502	CLIP-seq
MIRT1541186	hsa-miR-4712-5p	CLIP-seq
MIRT1541187	hsa-miR-4715-3p	CLIP-seq
MIRT1541190	hsa-miR-4768-5p	CLIP-seq
MIRT1541191	hsa-miR-4776-3p	CLIP-seq
MIRT2382534	hsa-miR-486-5p	CLIP-seq
MIRT1541193	hsa-miR-766	CLIP-seq
MIRT1541194	hsa-miR-770-5p	CLIP-seq
MIRT1541190	hsa-miR-4768-5p	CLIP-seq
MIRT2673305	hsa-miR-140-3p	CLIP-seq
MIRT1541180	hsa-miR-3064-3p	CLIP-seq
MIRT2673306	hsa-miR-3200-3p	CLIP-seq
MIRT1541187	hsa-miR-4715-3p	CLIP-seq
MIRT2673307	hsa-miR-4797-5p	CLIP-seq
MIRT2673308	hsa-miR-759	CLIP-seq
MIRT2673305	hsa-miR-140-3p	CLIP-seq
MIRT1541180	hsa-miR-3064-3p	CLIP-seq
MIRT2673306	hsa-miR-3200-3p	CLIP-seq
MIRT1541187	hsa-miR-4715-3p	CLIP-seq
MIRT2673307	hsa-miR-4797-5p	CLIP-seq
MIRT2673308	hsa-miR-759	CLIP-seq

Show/Hide all (11)

GO ID	Ontology	Definition	Evidence
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0008270	Function	Zinc ion binding	IEA
GO:0046872	Function	Metal ion binding	IEA

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

Q0VGE8

Protein name

Zinc finger protein 816

Protein function

May be involved in transcriptional regulation.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01352	KRAB	23 → 64	KRAB box	Family
PF00096	zf-C2H2	228 → 251	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	285 → 307	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	313 → 335	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	341 → 363	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	369 → 391	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	397 → 419	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	425 → 447	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	453 → 475	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	481 → 503	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	509 → 531	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	537 → 559	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	565 → 587	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	593 → 615	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	621 → 643	Zinc finger, C2H2 type	Domain

Sequence

MLREEATKKSKEKEPGMALPQGRLTFRDVAIEFSLEEWKCLNPAQRALYRAVMLENYRNL
EFVDSSLKSMMEFSSTRHSITGEVIHTGTLQRHKSHHIGDFCFPEMKKDIHHFEFQWQEV
ERNGHEAPMTKIKKLTGSTDRSDHRHAGNKPIKDQLGLSFHSHLPELHMFQTKGKISNQL
DKSIGASSASESQRISCRLKTHISNKYGKNFLHSSFTQIQEICMREKPCQSNECGKAFNY
SSLLRRHHITHSREREYKCDVCGKIFNQKQYIVYHHRCHTGEKTYKCNECGKTFTQMSSL
VCHRRLHTGEKPYKCNECGKTFSEKSSLRCHRRLHTGEKPYKCNECGKTFGRNSALVIHK
AIHTGEKPYKCNECGKTFSQKSSLQCHHILHTGEKPYKCEECDNVYIRRSHLERHRKIHT
GEGSYKCKVCDKVFRSDSYLAEHQRVHTGEKPYKCNKCGRSFSRKSSLQYHHTLHTGEKP
YTCNECGKVFSRRENLARHHRLHAGEKPYKCEECDKVFSRRSHLERHRRIHTGEKPYKCK
VCDKAFRSDSCLANHTRVHTGEKPYKCNKCAKVFNQKGILAQHQRVHTGEKPYKCNECGK
VFNQKASLAKHQRVHTAEKPYKCNECGKAFTGQSTLIHHQAIHGCRETLQM

Sequence length

651

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
GOUT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (6)

Disease Name	Disease (Merged)	Source	PMID	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	23252691	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	20953187, 23541940, 24212883	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	CTD_human_DG	20953187, 24212883	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis vulgaris	Psoriasis vulgaris	BEFREE	23252691	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	BEFREE	28199135	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pustulosis of Palms and Soles	Palmoplantar Pustules	CTD_human_DG	20953187, 24212883	★★★★★ ★☆☆☆☆ Found in Text Mining only

ZNF816 (zinc finger protein 816)