Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	125476
Gene name	INO80 complex subunit C
Gene symbol	INO80C
Synonyms (NCBI Gene)	C18orf37IES6hIes6
Chromosome	18
Chromosome location	18q12.2

Show/Hide all (93)

miRTarBase ID	miRNA	Experiments	Reference
MIRT002689	hsa-miR-124-3p	Proteomics;Microarray	18668037
MIRT002689	hsa-miR-124-3p	Microarray	15685193
MIRT657182	hsa-miR-494-3p	HITS-CLIP	23824327
MIRT657181	hsa-miR-6509-3p	HITS-CLIP	23824327
MIRT657180	hsa-miR-4436b-5p	HITS-CLIP	23824327
MIRT657179	hsa-miR-3692-3p	HITS-CLIP	23824327
MIRT657178	hsa-miR-510-3p	HITS-CLIP	23824327
MIRT612870	hsa-miR-548ac	HITS-CLIP	23824327
MIRT612869	hsa-miR-548bb-3p	HITS-CLIP	23824327
MIRT612868	hsa-miR-548d-3p	HITS-CLIP	23824327
MIRT612867	hsa-miR-548h-3p	HITS-CLIP	23824327
MIRT612866	hsa-miR-548z	HITS-CLIP	23824327
MIRT442780	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT612870	hsa-miR-548ac	HITS-CLIP	23824327
MIRT612869	hsa-miR-548bb-3p	HITS-CLIP	23824327
MIRT612868	hsa-miR-548d-3p	HITS-CLIP	23824327
MIRT612867	hsa-miR-548h-3p	HITS-CLIP	23824327
MIRT612866	hsa-miR-548z	HITS-CLIP	23824327
MIRT442780	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT612870	hsa-miR-548ac	HITS-CLIP	23824327
MIRT612869	hsa-miR-548bb-3p	HITS-CLIP	23824327
MIRT612868	hsa-miR-548d-3p	HITS-CLIP	23824327
MIRT612867	hsa-miR-548h-3p	HITS-CLIP	23824327
MIRT612866	hsa-miR-548z	HITS-CLIP	23824327
MIRT442780	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT612870	hsa-miR-548ac	HITS-CLIP	23824327
MIRT612869	hsa-miR-548bb-3p	HITS-CLIP	23824327
MIRT612868	hsa-miR-548d-3p	HITS-CLIP	23824327
MIRT612867	hsa-miR-548h-3p	HITS-CLIP	23824327
MIRT612866	hsa-miR-548z	HITS-CLIP	23824327
MIRT442780	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT612870	hsa-miR-548ac	HITS-CLIP	23824327
MIRT612869	hsa-miR-548bb-3p	HITS-CLIP	23824327
MIRT612868	hsa-miR-548d-3p	HITS-CLIP	23824327
MIRT612867	hsa-miR-548h-3p	HITS-CLIP	23824327
MIRT612866	hsa-miR-548z	HITS-CLIP	23824327
MIRT442780	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT442781	hsa-miR-543	PAR-CLIP	22100165
MIRT442780	hsa-miR-548as-3p	PAR-CLIP	22100165
MIRT442779	hsa-miR-9-3p	PAR-CLIP	22100165
MIRT442781	hsa-miR-543	PAR-CLIP	22100165
MIRT442780	hsa-miR-548as-3p	PAR-CLIP	22100165
MIRT442779	hsa-miR-9-3p	PAR-CLIP	22100165
MIRT657182	hsa-miR-494-3p	HITS-CLIP	23824327
MIRT657181	hsa-miR-6509-3p	HITS-CLIP	23824327
MIRT657180	hsa-miR-4436b-5p	HITS-CLIP	23824327
MIRT657179	hsa-miR-3692-3p	HITS-CLIP	23824327
MIRT657178	hsa-miR-510-3p	HITS-CLIP	23824327
MIRT612870	hsa-miR-548ac	HITS-CLIP	23824327
MIRT612869	hsa-miR-548bb-3p	HITS-CLIP	23824327
MIRT612868	hsa-miR-548d-3p	HITS-CLIP	23824327
MIRT612867	hsa-miR-548h-3p	HITS-CLIP	23824327
MIRT612866	hsa-miR-548z	HITS-CLIP	23824327
MIRT442780	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT612870	hsa-miR-548ac	HITS-CLIP	23824327
MIRT612869	hsa-miR-548bb-3p	HITS-CLIP	23824327
MIRT612868	hsa-miR-548d-3p	HITS-CLIP	23824327
MIRT612867	hsa-miR-548h-3p	HITS-CLIP	23824327
MIRT612866	hsa-miR-548z	HITS-CLIP	23824327
MIRT442780	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT612870	hsa-miR-548ac	HITS-CLIP	23824327
MIRT612869	hsa-miR-548bb-3p	HITS-CLIP	23824327
MIRT612868	hsa-miR-548d-3p	HITS-CLIP	23824327
MIRT612867	hsa-miR-548h-3p	HITS-CLIP	23824327
MIRT612866	hsa-miR-548z	HITS-CLIP	23824327
MIRT442780	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT612870	hsa-miR-548ac	HITS-CLIP	23824327
MIRT612869	hsa-miR-548bb-3p	HITS-CLIP	23824327
MIRT612868	hsa-miR-548d-3p	HITS-CLIP	23824327
MIRT612867	hsa-miR-548h-3p	HITS-CLIP	23824327
MIRT612866	hsa-miR-548z	HITS-CLIP	23824327
MIRT442780	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT612870	hsa-miR-548ac	HITS-CLIP	23824327
MIRT612869	hsa-miR-548bb-3p	HITS-CLIP	23824327
MIRT612868	hsa-miR-548d-3p	HITS-CLIP	23824327
MIRT612867	hsa-miR-548h-3p	HITS-CLIP	23824327
MIRT612866	hsa-miR-548z	HITS-CLIP	23824327
MIRT442780	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT442781	hsa-miR-543	PAR-CLIP	22100165
MIRT442780	hsa-miR-548as-3p	PAR-CLIP	22100165
MIRT442779	hsa-miR-9-3p	PAR-CLIP	22100165
MIRT442781	hsa-miR-543	PAR-CLIP	22100165
MIRT442780	hsa-miR-548as-3p	PAR-CLIP	22100165
MIRT442779	hsa-miR-9-3p	PAR-CLIP	22100165
MIRT1066811	hsa-miR-3655	CLIP-seq
MIRT1066812	hsa-miR-4778-3p	CLIP-seq
MIRT1066813	hsa-miR-578	CLIP-seq
MIRT1066814	hsa-miR-124	CLIP-seq
MIRT1066815	hsa-miR-1256	CLIP-seq
MIRT1066816	hsa-miR-3942-3p	CLIP-seq
MIRT1066817	hsa-miR-4720-5p	CLIP-seq
MIRT1066818	hsa-miR-4799-3p	CLIP-seq
MIRT1066819	hsa-miR-506	CLIP-seq

Show/Hide all (31)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000723	Process	Telomere maintenance	IEA
GO:0000723	Process	Telomere maintenance	ISO
GO:0001650	Component	Fibrillar center	IDA
GO:0005515	Function	Protein binding	IPI	26496610, 32814053, 33961781, 35271311
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005829	Component	Cytosol	IDA
GO:0006275	Process	Regulation of DNA replication	IMP	25016522
GO:0006281	Process	DNA repair	IEA
GO:0006282	Process	Regulation of DNA repair	IEA
GO:0006282	Process	Regulation of DNA repair	ISO
GO:0006310	Process	DNA recombination	IEA
GO:0006338	Process	Chromatin remodeling	IBA
GO:0006338	Process	Chromatin remodeling	IDA	21303910
GO:0006338	Process	Chromatin remodeling	IEA
GO:0006974	Process	DNA damage response	IEA
GO:0031011	Component	Ino80 complex	IBA
GO:0031011	Component	Ino80 complex	IDA	21303910
GO:0031011	Component	Ino80 complex	IEA
GO:0033044	Process	Regulation of chromosome organization	IMP	26340092
GO:0045739	Process	Positive regulation of DNA repair	IEA
GO:0045739	Process	Positive regulation of DNA repair	ISO
GO:0045893	Process	Positive regulation of DNA-templated transcription	IMP	27641337
GO:0045995	Process	Regulation of embryonic development	IEA
GO:0045995	Process	Regulation of embryonic development	ISO
GO:0051726	Process	Regulation of cell cycle	IMP	26340092
GO:0060382	Process	Regulation of DNA strand elongation	IMP	25016522
GO:0071339	Component	MLL1 complex	IDA	15960975
GO:1904507	Process	Positive regulation of telomere maintenance in response to DNA damage	IEA
GO:1904507	Process	Positive regulation of telomere maintenance in response to DNA damage	ISO

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

Q6PI98

Protein name

INO80 complex subunit C (IES6 homolog) (hIes6)

Protein function

Proposed core component of the chromatin remodeling INO80 complex which is involved in transcriptional regulation, DNA replication and probably DNA repair.

PDB

7ZI4

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF08265	YL1_C	142 → 170	YL1 nuclear protein C-terminal domain	Domain

Sequence

MAAQIPIVATTSTPGIVRNSKKRPASPSHNGSSGGGYGASKKKKASASSFAQGISMEAMS
ENKMVPSEFSTGPVEKAAKPLPFKDPNFVHSGHGGAVAGKKNRTWKNLKQILASERALPW
QLNDPNYFSIDAPPSFKPAKKYSDVSGLLANYTDPQSKLRFSTIEEFSYIRRLPSDVVTG
YLALRKATSIVP

Sequence length

192

Interactions

View interactions

	KEGG		Reactome
	ATP-dependent chromatin remodeling		UCH proteinases DNA Damage Recognition in GG-NER

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
COLOR VISION DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EOSINOPHILIC ESOPHAGITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (9)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Anxiety	Anxiety Disorder	BEFREE	31391069		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	31391069		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	28954733	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	31391069		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	31537905	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	31537905		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	31391069		★★★★★ ★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	31391069		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	31391069		★★★★★ ★☆☆☆☆ Found in Text Mining only

INO80C (INO80 complex subunit C)