KRT222 (keratin 222)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID 125113
Gene name Keratin 222
Gene symbol KRT222
Synonyms (NCBI Gene)
KA21KRT222P
Chromosome 17
Chromosome location 17q21.2
miRNA miRNA information provided by mirtarbase database.
33
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all (33)
miRTarBase ID miRNA Experiments Reference
MIRT029108 hsa-miR-26b-5p Microarray 19088304
MIRT515547 hsa-miR-1277-5p HITS-CLIP 21572407
MIRT515546 hsa-miR-5011-5p HITS-CLIP 21572407
MIRT515545 hsa-miR-654-3p HITS-CLIP 21572407
MIRT515544 hsa-miR-6758-3p HITS-CLIP 21572407
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
3
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all (3)
GO ID Ontology Definition Evidence Reference
GO:0005198 Function Structural molecule activity IEA
GO:0005515 Function Protein binding IPI 32296183, 32814053
GO:0005882 Component Intermediate filament IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8N1A0
Protein name Keratin-like protein KRT222 (Keratin-222) (Keratin-222 pseudogene)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00038 Filament 1 → 149 Intermediate filament protein Coiled-coil
Sequence 
MELSQLLNEIRANYEKILTRNQIETVLSTRIQLEEDISKKMDKDEEALKAAQAELKEARR
QWHHLQVEIESLHAVERGLENSLHASEQHYQMQLQDLETVIEGLEKELQEVRRGIEKQLQ
EHEMLLNTKMRLEQEIATYRHLLEKEEIRYYGCIQGGKKDKKPTTSRVGFVLPSAIINEI
SFTTKVPQKYENENVETVTKQAILNGSIVKESTEAHGTIQTEKVDEVIKEWEGSFFKDNP
RLRKKSVSLRFDLHLAATDEGCLETKQDNLPDIEVRLIMRRSCSIPSIKPPSTAN
Sequence length 295
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Show/Hide Unknown Diseases (1)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
ASTHMA — GWAS catalog
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Show/Hide Text Mining Associations (3)
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Carcinoma Renal Cell Renal cell carcinoma Pubtator 31140607 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Gingival Diseases Gingival diseases Pubtator 31743516 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Lymphoma Lymphoma BEFREE 22506574
★★★★★
★☆☆☆☆
Found in Text Mining only