HEXIM2 (HEXIM P-TEFb complex subunit 2)

Gene

• Entrez ID: 124790
• Gene name: HEXIM P-TEFb complex subunit 2
• Gene symbol: HEXIM2
• Synonyms (NCBI Gene): L3
• Chromosome: 17
• Chromosome location: 17q21.31
• Summary: This gene encodes a member of the HEXIM family of proteins. This protein is a component of the 7SK small nuclear ribonucleoprotein. This protein has been found to negatively regulate the kinase activity of the cyclin-dependent kinase P-TEFb, which phospho

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1044790	hsa-miR-3649	CLIP-seq
MIRT1044791	hsa-miR-3659	CLIP-seq
MIRT1044792	hsa-miR-4658	CLIP-seq
MIRT1044793	hsa-miR-574-5p	CLIP-seq
MIRT1044794	hsa-miR-648	CLIP-seq
MIRT2009766	hsa-miR-609	CLIP-seq
MIRT2009767	hsa-miR-876-3p	CLIP-seq
MIRT2242110	hsa-miR-3672	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IBA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	15713662
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0004861	Function	Cyclin-dependent protein serine/threonine kinase inhibitor activity	IBA
GO:0004861	Function	Cyclin-dependent protein serine/threonine kinase inhibitor activity	IDA	15713662
GO:0004861	Function	Cyclin-dependent protein serine/threonine kinase inhibitor activity	IEA
GO:0005515	Function	Protein binding	IPI	15713661, 15713662, 19883659, 21044950, 21516116, 25416956, 28514442, 32296183, 33961781
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005654	Component	Nucleoplasm	IBA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0005829	Component	Cytosol	IDA
GO:0010972	Process	Negative regulation of G2/M transition of mitotic cell cycle	IDA	15713662
GO:0016607	Component	Nuclear speck	IDA
GO:0017069	Function	SnRNA binding	IDA	15713662
GO:0017069	Function	SnRNA binding	IEA
GO:0042802	Function	Identical protein binding	IPI	21516116, 25416956, 32296183
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	15713662
GO:0097322	Function	7SK snRNA binding	IBA
GO:0097322	Function	7SK snRNA binding	IDA	19883659

Other IDs

• MIM: 615695
• HGNC: 28591
• e!Ensembl: ENSG00000168517

Protein

• UniProt ID: Q96MH2
• Protein name: Protein HEXIM2 (Hexamethylene bis-acetamide-inducible protein 2)
• Protein function: Transcriptional regulator which functions as a general RNA polymerase II transcription inhibitor (PubMed:15713661, PubMed:15713662). Core component of the 7SK RNP complex: in cooperation with 7SK snRNA sequesters P-TEFb in a large inactive 7SK s
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF15313	HEXIM	102 → 227	Hexamethylene bis-acetamide-inducible protein	Family

• Tissue specificity: TISSUE SPECIFICITY: Ubiquitously expressed with higher expression in testis. HEXIM1 and HEXIM2 are differentially expressed. {ECO:0000269|PubMed:15713661}.
• Sequence:

  MMATPNQTACNAESPVALEEAKTSGAPGSPQTPPERHDSGGSLPLTPRMESHSEDEDLAG
  AVGGLGWNSRSPRTQSPGGCSAEAVLARKKHRRRPSKRKRHWRPYLELSWAEKQQRDERQ
  SQRASRVREEMFAKGQPVAPYNTTQFLMNDRDPEEPNLDVPHGISHPGSSGESEAGDSDG
  RGRAHGEFQRKDFSETYERFHTESLQGRSKQELVRDYLELEKRLSQAEEETRRLQQLQAC
  TGQQSCRQVEELAAEVQRLRTENQRLRQENQMWNREGCRCDEEPGT

• Sequence length: 286

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ANDROGENETIC ALOPECIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	40026415	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	34482648	Associate	★☆☆☆☆ Found in Text Mining only