ZPBP2 (zona pellucida binding protein 2)

Gene

• Entrez ID: 124626
• Gene name: Zona pellucida binding protein 2
• Gene symbol: ZPBP2
• Synonyms (NCBI Gene): ZPBPL
• Chromosome: 17
• Chromosome location: 17q21.1

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT017875	hsa-miR-335-5p	Microarray	18185580
MIRT1543373	hsa-miR-185	CLIP-seq
MIRT1543374	hsa-miR-4306	CLIP-seq
MIRT1543375	hsa-miR-4644	CLIP-seq
MIRT1543376	hsa-miR-4802-5p	CLIP-seq
MIRT2163954	hsa-miR-1323	CLIP-seq
MIRT2163955	hsa-miR-3148	CLIP-seq
MIRT2163956	hsa-miR-3978	CLIP-seq
MIRT2163957	hsa-miR-548a-3p	CLIP-seq
MIRT2163958	hsa-miR-548an	CLIP-seq
MIRT2163959	hsa-miR-548e	CLIP-seq
MIRT2163960	hsa-miR-548f	CLIP-seq
MIRT2163961	hsa-miR-548g	CLIP-seq
MIRT2163962	hsa-miR-548o	CLIP-seq
MIRT2383119	hsa-miR-3120-3p	CLIP-seq
MIRT2383120	hsa-miR-331-5p	CLIP-seq
MIRT2383121	hsa-miR-3617	CLIP-seq
MIRT2383122	hsa-miR-3914	CLIP-seq
MIRT2383123	hsa-miR-3928	CLIP-seq
MIRT2383124	hsa-miR-4672	CLIP-seq
MIRT2383125	hsa-miR-4802-3p	CLIP-seq
MIRT1543376	hsa-miR-4802-5p	CLIP-seq
MIRT2383126	hsa-miR-641	CLIP-seq
MIRT2383127	hsa-miR-765	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001669	Component	Acrosomal vesicle	IBA
GO:0001669	Component	Acrosomal vesicle	IEA
GO:0001675	Process	Acrosome assembly	IBA
GO:0001675	Process	Acrosome assembly	IEA
GO:0002199	Component	Zona pellucida receptor complex	IBA
GO:0002199	Component	Zona pellucida receptor complex	IEA
GO:0002638	Process	Negative regulation of immunoglobulin production	IEA
GO:0005576	Component	Extracellular region	IEA
GO:0005634	Component	Nucleus	HDA	21630459
GO:0006665	Process	Sphingolipid metabolic process	IEA
GO:0007339	Process	Binding of sperm to zona pellucida	IBA
GO:0007339	Process	Binding of sperm to zona pellucida	IEA
GO:0007339	Process	Binding of sperm to zona pellucida	IEA
GO:0016020	Component	Membrane	IEA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0032922	Process	Circadian regulation of gene expression	IEA
GO:0044297	Component	Cell body	IEA
GO:0046466	Process	Membrane lipid catabolic process	IEA

Other IDs

• MIM: 608499
• HGNC: 20678
• e!Ensembl: ENSG00000186075

Protein

• UniProt ID: Q6X784
• Protein name: Zona pellucida-binding protein 2 (ZPBP-like protein)
• Protein function: Is implicated in sperm-oocyte interaction during fertilization.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF07354	Sp38	150 → 327	Zona-pellucida-binding protein (Sp38)	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed specifically in testis. {ECO:0000269|PubMed:17664285}.
• Sequence:

  MMRTCVLLSAVLWCLTGVQCPRFTLFNKKGFIYGKTGQPDKIYVELHQNSPVLICMDFKL
  SKKEIVDPTYLWIGPNEKTLTGNNRINITETGQLMVKDFLEPLSGLYTCTLSYKTVKAET
  QEEKTVKKRYDFMVFAYREPDYSYQMAVRFTTRSCIGRYNDVFFRVLKKILDSLISDLSC
  HVIEPSYKCHSVEIPEHGLIHELFIAFQVNPFAPGWKGACNGSVDCEDTTNHNILQARDR
  IEDFFRSQAYIFYHNFNKTLPAMHFVDHSLQVVRLDSCRPGFGKNERLHSNCASCCVVCS
  PATFSPDVNVTCQTCVSVLTYGAKSCPQTSNKNQQYED

• Sequence length: 338

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ANKYLOSING SPONDYLITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FLUTTER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE THYROID DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
B-CELL ACUTE LYMPHOBLASTIC LEUKEMIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CELIAC DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CERVICAL CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CERVICAL CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHILDHOOD ONSET ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COMMON VARIABLE IMMUNODEFICIENCY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
JUVENILE IDIOPATHIC ARTHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY BILIARY CIRRHOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCLEROSING CHOLANGITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEASONAL ALLERGIC RHINITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC SCLERODERMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 1 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Allergic rhinitis (disorder)	Allergic rhinitis	GWASCAT_DG	30013184		★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	GWASCAT_DG	26974007		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	BEFREE	19732864, 22271045, 23546690, 25433770, 26671913, 27130862, 28241063, 29536159		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	19732864, 21985515, 22271045, 25895113, 27835674, 27848966, 28241063, 31439681, 32240371, 33653805, 36967681	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	GWASDB_DG	20860503, 21804549		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	GWASCAT_DG	27182965		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atrial Fibrillation	Atrial Fibrillation	CTD_human_DG	29892015		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atrial Fibrillation	Atrial Fibrillation	GWASCAT_DG	30061737		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Diseases	Autoimmune Diseases	BEFREE	19732864		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	19732864	Associate	★☆☆☆☆ Found in Text Mining only
Childhood asthma	Asthma	GWASDB_DG	17611496		★☆☆☆☆ Found in Text Mining only
Cholangitis, Sclerosing	Cholangitis	GWASCAT_DG	26974007		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	26484354		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	26484354	Inhibit	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	GWASCAT_DG	26974007		★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves disease	Pubtator	29510406	Associate	★☆☆☆☆ Found in Text Mining only
Hyperuricemia	Hyperuricemia	BEFREE	21594610		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	25895113	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	26484354		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	26484354	Inhibit	★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	28588209	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	22464253, 25271777	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	22464253, 28427360		★☆☆☆☆ Found in Text Mining only
Paroxysmal atrial fibrillation	Paroxysmal atrial fibrillation	CTD_human_DG	29892015		★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	GWASDB_DG	22936693, 22961000		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	28588209		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	GWASCAT_DG	26974007		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	GWASCAT_DG	30423114		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ulcerative Colitis	Ulcerative colitis	GWASCAT_DG	26974007		★★☆☆☆ Found in Text Mining + Unknown/Other Associations