Gene Gene information from NCBI Gene database.
Entrez ID 124590
Gene name USH1 protein network component sans
Gene symbol USH1G
Synonyms (NCBI Gene)
ANKS4ASANS
Chromosome 17
Chromosome location 17q25.1
Summary This gene encodes a protein that contains three ankyrin domains, a class I PDZ-binding motif and a sterile alpha motif. The encoded protein interacts with harmonin, which is associated with Usher syndrome type 1C. This protein plays a role in the developm
SNPs SNP information provided by dbSNP.
15
SNP ID Visualize variation Clinical significance Consequence
rs142486910 G>C Conflicting-interpretations-of-pathogenicity, uncertain-significance Coding sequence variant, missense variant
rs147967199 T>G Conflicting-interpretations-of-pathogenicity, likely-benign Missense variant, coding sequence variant
rs201866631 C>A,T Pathogenic, uncertain-significance Stop gained, coding sequence variant, missense variant
rs397515345 ACGCTGTCCTCGTCCGAGAG>- Pathogenic Frameshift variant, coding sequence variant
rs397517925 T>A Likely-pathogenic Coding sequence variant, missense variant
miRNA miRNA information provided by mirtarbase database.
279
miRTarBase ID miRNA Experiments Reference
MIRT621598 hsa-miR-8485 HITS-CLIP 23824327
MIRT611302 hsa-miR-4643 HITS-CLIP 23824327
MIRT611301 hsa-miR-8064 HITS-CLIP 23824327
MIRT621598 hsa-miR-8485 HITS-CLIP 23824327
MIRT611302 hsa-miR-4643 HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
39
GO ID Ontology Definition Evidence Reference
GO:0001917 Component Photoreceptor inner segment IDA 24608321
GO:0001917 Component Photoreceptor inner segment IEA
GO:0005515 Function Protein binding IPI 19028668, 20142502, 24608321, 25502805, 27173435, 28514442, 29997244, 31515488, 31637240, 32296183, 32814053, 33961781
GO:0005634 Component Nucleus IEA
GO:0005737 Component Cytoplasm IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
607696 16356 ENSG00000182040
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q495M9
Protein name pre-mRNA splicing regulator USH1G (Scaffold protein containing ankyrin repeats and SAM domain) (Usher syndrome type-1G protein)
Protein function Plays a role in pre-mRNA splicing by regulating the release and transfer of U4/U6.U5 tri-small nuclear ribonucleoprotein (tri-snRNP) complexes from their assembly site in Cajal bodies to nuclear speckles, thereby contributing to the assembly of
PDB 2L7T , 3K1R , 3PVL
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF12796 Ank_2 37 126 Ankyrin repeats (3 copies) Repeat
PF00536 SAM_1 388 447 SAM domain (Sterile alpha motif) Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in vestibule of the inner ear, eye and small intestine. {ECO:0000269|PubMed:12588794}.
Sequence
MNDQYHRAARDGYLELLKEATRKELNAPDEDGMTPTLWAAYHGNLESLRLIVSRGGDPDK
CDIWGNTPLHLAASNGHLHCLSFLVSFGANIWCLDNDYHTPLDMAAMKGHMECVRYLDSI
AAKQSS
LNPKLVGKLKDKAFREAERRIRECAKLQRRHHERMERRYRRELAERSDTLSFSS
LTSSTLSRRLQHLALGSHLPYSQATLHGTARGKTKMQKKLERRKQGGEGTFKVSEDGRKS
ARSLSGLQLGSDVMFVRQGTYANPKEWGRAPLRDMFLSDEDSVSRATLAAEPAHSEVSTD
SGHDSLFTRPGLGTMVFRRNYLSSGLHGLGREDGGLDGVGAPRGRLQSSPSLDDDSLGSA
NSLQDRSCGEELPWDELDLGLDEDLEPETSPLETFLASLHMEDFAALLRQEKIDLEALML
CSDLDLRSISVPLGPRKKILGAVRRRR
QAMERPPALEDTEL
Sequence length 461
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
22
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
Deafness Likely pathogenic; Pathogenic rs1567939793, rs201866631 RCV000679845
RCV000679846
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Hearing impairment Likely pathogenic; Pathogenic rs1567939718, rs1567940507 RCV000754557
RCV000754558
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Hearing loss, autosomal recessive Likely pathogenic; Pathogenic rs1567939793, rs201866631 RCV001291496
RCV001291495
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Rare genetic deafness Likely pathogenic; Pathogenic rs397517925 RCV000041415
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
Autosomal recessive nonsyndromic hearing loss 18A Uncertain significance ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney Conflicting classifications of pathogenicity ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
DEAFNESS, AUTOSOMAL RECESSIVE Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Anxiety Anxiety Disorder HPO_DG
★☆☆☆☆
Found in Text Mining only
Aphasia Aphasia BEFREE 29128326
★☆☆☆☆
Found in Text Mining only
Cataract Cataract HPO_DG
★☆☆☆☆
Found in Text Mining only
Cerebral cortical atrophy Cerebral cortical atrophy HPO_DG
★☆☆☆☆
Found in Text Mining only
Ciliopathies Ciliopathy Pubtator 34023904 Associate
★☆☆☆☆
Found in Text Mining only
Ciliopathies Ciliopathies GENOMICS_ENGLAND_DG
★☆☆☆☆
Found in Text Mining only
Congenital sensorineural hearing loss Congenital Sensorineural Hearing Loss CLINVAR_DG
★☆☆☆☆
Found in Text Mining only
Deafness Deafness Pubtator 33095980 Associate
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Depressive disorder Mental Depression BEFREE 19361959
★☆☆☆☆
Found in Text Mining only
Depressive disorder Mental Depression HPO_DG
★☆☆☆☆
Found in Text Mining only