Gene Gene information from NCBI Gene database.
Entrez ID 124401
Gene name Ankyrin repeat and sterile alpha motif domain containing 3
Gene symbol ANKS3
Synonyms (NCBI Gene)
-
Chromosome 16
Chromosome location 16p13.3
SNPs SNP information provided by dbSNP.
1
SNP ID Visualize variation Clinical significance Consequence
rs1567280099 ->G Pathogenic Frameshift variant, non coding transcript variant, genic downstream transcript variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
11
miRTarBase ID miRNA Experiments Reference
MIRT022874 hsa-miR-124-3p Microarray 18668037
MIRT2172079 hsa-miR-3127-5p CLIP-seq
MIRT2172080 hsa-miR-3619-3p CLIP-seq
MIRT2172081 hsa-miR-4705 CLIP-seq
MIRT2172082 hsa-miR-4776-5p CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
6
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 24998259, 26188091
GO:0005737 Component Cytoplasm IEA
GO:0005737 Component Cytoplasm ISS
GO:0005929 Component Cilium IBA
GO:0005929 Component Cilium IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
617310 29422 ENSG00000168096
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q6ZW76
Protein name Ankyrin repeat and SAM domain-containing protein 3
Protein function May be involved in vasopressin signaling in the kidney.
PDB 4NJ8 , 4NL9
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF12796 Ank_2 39 132 Ankyrin repeats (3 copies) Repeat
PF12796 Ank_2 131 199 Ankyrin repeats (3 copies) Repeat
PF13637 Ank_4 135 189 Repeat
PF00536 SAM_1 424 486 SAM domain (Sterile alpha motif) Domain
Sequence
MSELSDEASEPELLNRSLSMWHGLGTQVSGEELDVPLDLHTAASIGQYEVVKECVQRREL
DLNKKNGGGWTPLMYASYIGHDTIVHLLLEAGVSVNVPTPEGQTPLMLASSCGNESIAYF
LLQQGAELEM
KDIQGWTALFHCTSAGHQHMVRFLLDSGANANVREPICGFTPLMEAAAAG
HEIIVQYFL
NHGVKVDARD
HSGATARMLAKQYGHMKIVALMDTYSPSLPKSLYRSPEKYE
DLSSSDESCPAPQRQRPCRKKGVSIHEGPRALARITGIGLGGRAPRPRYEQAPPRGYVTF
NSSGENPLEEEGLCCRDVTSPINERDVESSSSSSSREEHAFCANLGPVQSSSSSEGLARA
QGLSSEASVESNEDSDHACKSSARKQAKSYMKTKNPDSQWPPRAATDREGFLAESSPQTQ
RAPYSGPQDLAALLEQIGCLKYLQVFEEQDVDLRIFLTLTESDLKEIGITLFGPKRKMTS
AIARWH
SSARPPGDALELAYADRLEAEMQELAIQLHKRCEEVEATRGQVCQEQELRAVVE
SCLLEQDRAREDLQARLRETWALARDAALVLDQLRACQAELSSRVRQDQPPGAATLGLAV
PPADSKGWQASLQAMSLPELSGALEDRVREMGQALCLVTQSLEKLQVLNGKKWRET
Sequence length 656
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
13
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
Short stature Pathogenic rs1567280099 RCV000736202
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
ANKS3-related disorder Likely benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Cervical cancer Likely benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Familial cancer of breast Likely benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Gastric cancer Likely benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Cystic kidney Cystic Kidney Disease BEFREE 29290488
★☆☆☆☆
Found in Text Mining only
Episodic Kinesigenic Dyskinesia 1 Episodic Kinesigenic Dyskinesia BEFREE 26039630
★☆☆☆☆
Found in Text Mining only
Hydrocephalus, Normal Pressure Hydrocephalus BEFREE 25671767, 26188091
★☆☆☆☆
Found in Text Mining only
Nephronophthisis Nephronophthisis BEFREE 29899363
★☆☆☆☆
Found in Text Mining only
Nephronophthisis familial juvenile Nephronophthisis Pubtator 32994509 Associate
★☆☆☆☆
Found in Text Mining only
Situs Inversus Situs Inversus ORPHANET_DG 27417436
★★☆☆☆
Found in Text Mining + Unknown/Other Associations