Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	124359
Gene name	Chromodomain Y like 2
Gene symbol	CDYL2
Synonyms (NCBI Gene)	PCCP1
Chromosome	16
Chromosome location	16q23.2

138

Show/Hide all (138)

miRTarBase ID	miRNA	Experiments
MIRT882848	hsa-miR-1178	CLIP-seq
MIRT882849	hsa-miR-1197	CLIP-seq
MIRT882850	hsa-miR-1299	CLIP-seq
MIRT882851	hsa-miR-1343	CLIP-seq
MIRT882852	hsa-miR-3127-3p	CLIP-seq
MIRT882853	hsa-miR-3173-3p	CLIP-seq
MIRT882854	hsa-miR-3545-5p	CLIP-seq
MIRT882855	hsa-miR-3667-3p	CLIP-seq
MIRT882856	hsa-miR-3690	CLIP-seq
MIRT882857	hsa-miR-3691-3p	CLIP-seq
MIRT882858	hsa-miR-3926	CLIP-seq
MIRT882859	hsa-miR-3934	CLIP-seq
MIRT882860	hsa-miR-3941	CLIP-seq
MIRT882861	hsa-miR-4254	CLIP-seq
MIRT882862	hsa-miR-4291	CLIP-seq
MIRT882863	hsa-miR-4480	CLIP-seq
MIRT882864	hsa-miR-4527	CLIP-seq
MIRT882865	hsa-miR-466	CLIP-seq
MIRT882866	hsa-miR-4672	CLIP-seq
MIRT882867	hsa-miR-4731-3p	CLIP-seq
MIRT882868	hsa-miR-4796-3p	CLIP-seq
MIRT882869	hsa-miR-4799-5p	CLIP-seq
MIRT882870	hsa-miR-4801	CLIP-seq
MIRT882871	hsa-miR-545	CLIP-seq
MIRT882872	hsa-miR-548s	CLIP-seq
MIRT882873	hsa-miR-587	CLIP-seq
MIRT882874	hsa-miR-765	CLIP-seq
MIRT882875	hsa-miR-875-3p	CLIP-seq
MIRT882876	hsa-miR-885-5p	CLIP-seq
MIRT1961713	hsa-miR-1207-5p	CLIP-seq
MIRT1961714	hsa-miR-1233	CLIP-seq
MIRT1961715	hsa-miR-1250	CLIP-seq
MIRT1961716	hsa-miR-1275	CLIP-seq
MIRT1961717	hsa-miR-1276	CLIP-seq
MIRT1961718	hsa-miR-1321	CLIP-seq
MIRT882851	hsa-miR-1343	CLIP-seq
MIRT1961719	hsa-miR-208a	CLIP-seq
MIRT1961720	hsa-miR-208b	CLIP-seq
MIRT1961721	hsa-miR-2110	CLIP-seq
MIRT1961722	hsa-miR-2277-3p	CLIP-seq
MIRT1961723	hsa-miR-3126-3p	CLIP-seq
MIRT882852	hsa-miR-3127-3p	CLIP-seq
MIRT1961724	hsa-miR-3153	CLIP-seq
MIRT1961725	hsa-miR-3166	CLIP-seq
MIRT1961726	hsa-miR-3176	CLIP-seq
MIRT1961727	hsa-miR-3189-3p	CLIP-seq
MIRT1961728	hsa-miR-3194-3p	CLIP-seq
MIRT1961729	hsa-miR-3202	CLIP-seq
MIRT1961730	hsa-miR-326	CLIP-seq
MIRT1961731	hsa-miR-330-5p	CLIP-seq
MIRT1961732	hsa-miR-338-5p	CLIP-seq
MIRT1961733	hsa-miR-34b	CLIP-seq
MIRT1961734	hsa-miR-3658	CLIP-seq
MIRT882855	hsa-miR-3667-3p	CLIP-seq
MIRT1961735	hsa-miR-3667-5p	CLIP-seq
MIRT1961736	hsa-miR-3689d	CLIP-seq
MIRT882856	hsa-miR-3690	CLIP-seq
MIRT882857	hsa-miR-3691-3p	CLIP-seq
MIRT1961737	hsa-miR-3922-3p	CLIP-seq
MIRT882858	hsa-miR-3926	CLIP-seq
MIRT1961738	hsa-miR-3940-5p	CLIP-seq
MIRT882861	hsa-miR-4254	CLIP-seq
MIRT1961739	hsa-miR-4257	CLIP-seq
MIRT1961740	hsa-miR-4263	CLIP-seq
MIRT1961741	hsa-miR-4270	CLIP-seq
MIRT1961742	hsa-miR-4271	CLIP-seq
MIRT1961743	hsa-miR-4292	CLIP-seq
MIRT1961744	hsa-miR-4293	CLIP-seq
MIRT1961745	hsa-miR-4311	CLIP-seq
MIRT1961746	hsa-miR-4428	CLIP-seq
MIRT1961747	hsa-miR-4435	CLIP-seq
MIRT1961748	hsa-miR-4436b-3p	CLIP-seq
MIRT1961749	hsa-miR-4441	CLIP-seq
MIRT1961750	hsa-miR-4476	CLIP-seq
MIRT882863	hsa-miR-4480	CLIP-seq
MIRT1961751	hsa-miR-4499	CLIP-seq
MIRT1961752	hsa-miR-4507	CLIP-seq
MIRT1961753	hsa-miR-450b-5p	CLIP-seq
MIRT1961754	hsa-miR-4646-5p	CLIP-seq
MIRT1961755	hsa-miR-4649-3p	CLIP-seq
MIRT1961756	hsa-miR-4665-5p	CLIP-seq
MIRT1961757	hsa-miR-4725-3p	CLIP-seq
MIRT1961758	hsa-miR-4730	CLIP-seq
MIRT1961759	hsa-miR-4739	CLIP-seq
MIRT1961760	hsa-miR-4743	CLIP-seq
MIRT1961761	hsa-miR-4746-3p	CLIP-seq
MIRT1961762	hsa-miR-4747-5p	CLIP-seq
MIRT1961763	hsa-miR-4756-5p	CLIP-seq
MIRT1961764	hsa-miR-4763-3p	CLIP-seq
MIRT882869	hsa-miR-4799-5p	CLIP-seq
MIRT1961765	hsa-miR-486-3p	CLIP-seq
MIRT1961766	hsa-miR-491-5p	CLIP-seq
MIRT1961767	hsa-miR-499-5p	CLIP-seq
MIRT1961768	hsa-miR-515-5p	CLIP-seq
MIRT1961769	hsa-miR-518a-5p	CLIP-seq
MIRT1961770	hsa-miR-527	CLIP-seq
MIRT882872	hsa-miR-548s	CLIP-seq
MIRT1961771	hsa-miR-576-5p	CLIP-seq
MIRT1961772	hsa-miR-583	CLIP-seq
MIRT1961773	hsa-miR-629	CLIP-seq
MIRT1961774	hsa-miR-633	CLIP-seq
MIRT1961775	hsa-miR-636	CLIP-seq
MIRT1961776	hsa-miR-892a	CLIP-seq
MIRT1961714	hsa-miR-1233	CLIP-seq
MIRT1961715	hsa-miR-1250	CLIP-seq
MIRT1961723	hsa-miR-3126-3p	CLIP-seq
MIRT1961725	hsa-miR-3166	CLIP-seq
MIRT1961727	hsa-miR-3189-3p	CLIP-seq
MIRT1961732	hsa-miR-338-5p	CLIP-seq
MIRT1961733	hsa-miR-34b	CLIP-seq
MIRT882857	hsa-miR-3691-3p	CLIP-seq
MIRT2198329	hsa-miR-377	CLIP-seq
MIRT882858	hsa-miR-3926	CLIP-seq
MIRT882859	hsa-miR-3934	CLIP-seq
MIRT1961743	hsa-miR-4292	CLIP-seq
MIRT1961746	hsa-miR-4428	CLIP-seq
MIRT1961748	hsa-miR-4436b-3p	CLIP-seq
MIRT882863	hsa-miR-4480	CLIP-seq
MIRT2198330	hsa-miR-4487	CLIP-seq
MIRT1961751	hsa-miR-4499	CLIP-seq
MIRT1961753	hsa-miR-450b-5p	CLIP-seq
MIRT1961754	hsa-miR-4646-5p	CLIP-seq
MIRT1961755	hsa-miR-4649-3p	CLIP-seq
MIRT1961758	hsa-miR-4730	CLIP-seq
MIRT1961760	hsa-miR-4743	CLIP-seq
MIRT1961761	hsa-miR-4746-3p	CLIP-seq
MIRT1961762	hsa-miR-4747-5p	CLIP-seq
MIRT882869	hsa-miR-4799-5p	CLIP-seq
MIRT1961765	hsa-miR-486-3p	CLIP-seq
MIRT1961769	hsa-miR-518a-5p	CLIP-seq
MIRT1961770	hsa-miR-527	CLIP-seq
MIRT882872	hsa-miR-548s	CLIP-seq
MIRT1961773	hsa-miR-629	CLIP-seq
MIRT1961775	hsa-miR-636	CLIP-seq
MIRT882859	hsa-miR-3934	CLIP-seq
MIRT1961746	hsa-miR-4428	CLIP-seq
MIRT1961751	hsa-miR-4499	CLIP-seq
MIRT1961755	hsa-miR-4649-3p	CLIP-seq

Show/Hide all (8)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003714	Function	Transcription corepressor activity	IBA
GO:0005515	Function	Protein binding	IPI	17577209, 23455924, 32296183
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0006325	Process	Chromatin organization	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0061628	Function	Histone H3K27me3 reader activity	IEA
GO:0062072	Function	Histone H3K9me2/3 reader activity	IEA

MIM	HGNC	e!Ensembl
618816	23030	ENSG00000166446

Q8N8U2

Protein name

Chromodomain Y-like protein 2 (CDY-like 2)

PDB

2MJ8 , 4HAE , 5JJZ , 6V2D , 6V2H , 6V3N , 6V8W , 8SP6

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00385	Chromo	7 → 57	Chromo (CHRromatin Organisation MOdifier) domain	Domain
PF00378	ECH_1	255 → 502	Enoyl-CoA hydratase/isomerase	Domain

Tissue specificity

TISSUE SPECIFICITY: Ubiquitously expressed. {ECO:0000269|PubMed:12837688}.

Sequence

MASGDLYEVERIVDKRKNKKGKWEYLIRWKGYGSTEDTWEPEHHLLHCEEFIDEFNGLHM
SKDKRIKSGKQSSTSKLLRDSRGPSVEKLSHRPSDPGKSKGTSHKRKRINPPLAKPKKGY
SGKPSSGGDRATKTVSYRTTPSGLQIMPLKKSQNGMENGDAGSEKDERHFGNGSHQPGLD
LNDHVGEQDMGECDVNHATLAENGLGSALTNGGLNLHSPVKRKLEAEKDYVFDKRLRYSV
RQNESNCRFRDIVVRKEEGFTHILLSSQTSDNNALTPEIMKEVRRALCNAATDDSKLLLL
SAVGSVFCSGLDYSYLIGRLSSDRRKESTRIAEAIRDFVKAFIQFKKPIVVAINGPALGL
GASILPLCDIVWASEKAWFQTPYATIRLTPAGCSSYTFPQILGVALANEMLFCGRKLTAQ
EACSRGLVSQVFWPTTFSQEVMLRVKEMASCSAVVLEESKCLVRSFLKSVLEDVNEKECL
MLKQLWSSSKGLDSLFSYLQDKIYEV

Sequence length

506

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (19)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ANDROGENETIC ALOPECIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DISORDER OF ACID-BASE BALANCE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESTROGEN-RECEPTOR NEGATIVE BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IDIOPATHIC PULMONARY FIBROSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN ENDOMETRIOID CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN SEROUS CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (5)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Breast Carcinoma	Breast Carcinoma	GWASCAT_DG	23535729, 25751625, 29059683		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	23593120, 30594178	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	27569725		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	GWASCAT_DG	27569725		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	GWASDB_DG	23535729		★★★★★ ★☆☆☆☆ Found in Text Mining only

CDYL2 (chromodomain Y like 2)