Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Other IDs Protein Associated diseases
Entrez ID	124152
Gene name	IQ motif containing K
Gene symbol	IQCK
Synonyms (NCBI Gene)	-
Chromosome	16
Chromosome location	16p12.3
Summary	This gene belongs to the IQ motif-containing family of proteins. The IQ motif serves as a binding site for different EF-hand proteins such as calmodulin. This gene was identified as a potential candidate gene for obsessive-compulsive disorder in a genome-

Show/Hide all (57)

miRTarBase ID	miRNA	Experiments	Reference
MIRT023147	hsa-miR-124-3p	Microarray	18668037
MIRT1069713	hsa-miR-4457	CLIP-seq
MIRT1069714	hsa-miR-513b	CLIP-seq
MIRT1069715	hsa-miR-548ag	CLIP-seq
MIRT1069716	hsa-miR-548ai	CLIP-seq
MIRT1069717	hsa-miR-660	CLIP-seq
MIRT2017166	hsa-miR-1200	CLIP-seq
MIRT2017167	hsa-miR-1207-3p	CLIP-seq
MIRT2017168	hsa-miR-1231	CLIP-seq
MIRT2017169	hsa-miR-138	CLIP-seq
MIRT2017170	hsa-miR-1827	CLIP-seq
MIRT2017171	hsa-miR-3120-5p	CLIP-seq
MIRT2017172	hsa-miR-3121-5p	CLIP-seq
MIRT2017173	hsa-miR-4289	CLIP-seq
MIRT2017174	hsa-miR-4324	CLIP-seq
MIRT2017175	hsa-miR-4649-3p	CLIP-seq
MIRT2017176	hsa-miR-501-5p	CLIP-seq
MIRT2017177	hsa-miR-502-5p	CLIP-seq
MIRT2017178	hsa-miR-544b	CLIP-seq
MIRT2017179	hsa-miR-629	CLIP-seq
MIRT2017180	hsa-miR-646	CLIP-seq
MIRT2249126	hsa-miR-374a	CLIP-seq
MIRT2249127	hsa-miR-374b	CLIP-seq
MIRT2451918	hsa-miR-1246	CLIP-seq
MIRT2451919	hsa-miR-4484	CLIP-seq
MIRT2451920	hsa-miR-450b-5p	CLIP-seq
MIRT2451921	hsa-miR-518a-5p	CLIP-seq
MIRT2451922	hsa-miR-527	CLIP-seq
MIRT2017168	hsa-miR-1231	CLIP-seq
MIRT2552721	hsa-miR-3065-5p	CLIP-seq
MIRT2017171	hsa-miR-3120-5p	CLIP-seq
MIRT2017172	hsa-miR-3121-5p	CLIP-seq
MIRT2552722	hsa-miR-4668-3p	CLIP-seq
MIRT2552723	hsa-miR-500a	CLIP-seq
MIRT2017176	hsa-miR-501-5p	CLIP-seq
MIRT2552724	hsa-miR-548c-3p	CLIP-seq
MIRT2017179	hsa-miR-629	CLIP-seq
MIRT2017168	hsa-miR-1231	CLIP-seq
MIRT2552721	hsa-miR-3065-5p	CLIP-seq
MIRT2017171	hsa-miR-3120-5p	CLIP-seq
MIRT2017172	hsa-miR-3121-5p	CLIP-seq
MIRT2682891	hsa-miR-3147	CLIP-seq
MIRT2682892	hsa-miR-3173-3p	CLIP-seq
MIRT2682893	hsa-miR-3545-5p	CLIP-seq
MIRT2682894	hsa-miR-3940-5p	CLIP-seq
MIRT2682895	hsa-miR-4425	CLIP-seq
MIRT2682896	hsa-miR-4428	CLIP-seq
MIRT2682897	hsa-miR-4477b	CLIP-seq
MIRT2682898	hsa-miR-4507	CLIP-seq
MIRT2552722	hsa-miR-4668-3p	CLIP-seq
MIRT2552723	hsa-miR-500a	CLIP-seq
MIRT2017176	hsa-miR-501-5p	CLIP-seq
MIRT2552724	hsa-miR-548c-3p	CLIP-seq
MIRT2682899	hsa-miR-548n	CLIP-seq
MIRT2682900	hsa-miR-548t	CLIP-seq
MIRT2682901	hsa-miR-595	CLIP-seq
MIRT2017179	hsa-miR-629	CLIP-seq

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

Q8N0W5

Protein name

IQ domain-containing protein K

Family and domains

Sequence

MAAPRQIPSHIVRLKPSCSTDSSFTRTPVPTVSLASRELPVSSWQVTEPSSKNLWEQICK
EYEAEQPPFPEGYKVKQEPVITVAPVEEMLFHGFSAEHYFPVSHFTMISRTPCPQDKSET
INPKTCSPKEYLETFIFPVLLPGMASLLHQAKKEKCFERKRTKFIACDFLTEWLYNQNPK
RAGEPFTEFFSIPFVEERLKQHPRPPIPLSLLLTEEEAALYIQSFWRACVVRCDPEIQEL
RQWQKKLREAKHIHQQVKIFWAKQEQKVKCKMEDDAVPAAKMKIPSS

Sequence length

287

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (7)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ALZHEIMERS DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTROESOPHAGEAL REFLUX DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LATE-ONSET ALZHEIMER'S DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (11)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute Confusional Senile Dementia	Senile Dementia	CTD_human_DG	30820047		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	32740652, 34767070	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Alzheimer Disease, Early Onset	Alzheimer disease	CTD_human_DG	30820047		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	BEFREE	30820047		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	CTD_human_DG	30820047		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease	Alzheimer disease	CTD_human_DG	30820047		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease, Focal Onset	Alzheimer disease	CTD_human_DG	30820047		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial Alzheimer Disease (FAD)	Alzheimer disease	CTD_human_DG	30820047		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple System Atrophy	Multiple system atrophy	Pubtator	27470294	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	24788522		★★★★★ ★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	CTD_human_DG	30820047		★★★★★ ★☆☆☆☆ Found in Text Mining only

IQCK (IQ motif containing K)