LTB4R (leukotriene B4 receptor)

Gene

• Entrez ID: 1241
• Gene name: Leukotriene B4 receptor
• Gene symbol: LTB4R
• Synonyms (NCBI Gene): BLT1, BLTR, CMKRL1, GPR16, LTB4R1, LTBR1, P2RY7, P2Y7
• Chromosome: 14
• Chromosome location: 14q12

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1122096	hsa-miR-1207-3p	CLIP-seq
MIRT1122097	hsa-miR-122	CLIP-seq
MIRT1122098	hsa-miR-2117	CLIP-seq
MIRT1122099	hsa-miR-3161	CLIP-seq
MIRT1122100	hsa-miR-371-5p	CLIP-seq
MIRT1122101	hsa-miR-371b-5p	CLIP-seq
MIRT1122102	hsa-miR-4254	CLIP-seq
MIRT1122103	hsa-miR-4273	CLIP-seq
MIRT1122104	hsa-miR-4281	CLIP-seq
MIRT1122105	hsa-miR-4330	CLIP-seq
MIRT1122106	hsa-miR-4449	CLIP-seq
MIRT1122107	hsa-miR-4491	CLIP-seq
MIRT1122108	hsa-miR-4519	CLIP-seq
MIRT1122109	hsa-miR-4532	CLIP-seq
MIRT1122110	hsa-miR-4657	CLIP-seq
MIRT1122111	hsa-miR-4684-3p	CLIP-seq
MIRT1122112	hsa-miR-4754	CLIP-seq
MIRT1122113	hsa-miR-4765	CLIP-seq
MIRT1122114	hsa-miR-490-3p	CLIP-seq
MIRT1122115	hsa-miR-493	CLIP-seq
MIRT1122116	hsa-miR-512-3p	CLIP-seq
MIRT1122117	hsa-miR-513c	CLIP-seq
MIRT1122118	hsa-miR-514b-5p	CLIP-seq
MIRT1122119	hsa-miR-619	CLIP-seq
MIRT1122120	hsa-miR-1179	CLIP-seq
MIRT1122096	hsa-miR-1207-3p	CLIP-seq
MIRT1122121	hsa-miR-149	CLIP-seq
MIRT1122098	hsa-miR-2117	CLIP-seq
MIRT1122122	hsa-miR-24	CLIP-seq
MIRT1122100	hsa-miR-371-5p	CLIP-seq
MIRT1122101	hsa-miR-371b-5p	CLIP-seq
MIRT1122103	hsa-miR-4273	CLIP-seq
MIRT1122123	hsa-miR-4284	CLIP-seq
MIRT1122124	hsa-miR-4727-5p	CLIP-seq
MIRT1122125	hsa-miR-4769-3p	CLIP-seq
MIRT1122117	hsa-miR-513c	CLIP-seq
MIRT1122118	hsa-miR-514b-5p	CLIP-seq
MIRT1122126	hsa-miR-621	CLIP-seq
MIRT1122127	hsa-miR-892b	CLIP-seq
MIRT1122096	hsa-miR-1207-3p	CLIP-seq
MIRT1122098	hsa-miR-2117	CLIP-seq
MIRT1122100	hsa-miR-371-5p	CLIP-seq
MIRT1122101	hsa-miR-371b-5p	CLIP-seq
MIRT1122103	hsa-miR-4273	CLIP-seq
MIRT1122117	hsa-miR-513c	CLIP-seq
MIRT1122118	hsa-miR-514b-5p	CLIP-seq
MIRT2034494	hsa-miR-642a	CLIP-seq
MIRT1122096	hsa-miR-1207-3p	CLIP-seq
MIRT2390388	hsa-miR-1281	CLIP-seq
MIRT1122098	hsa-miR-2117	CLIP-seq
MIRT1122100	hsa-miR-371-5p	CLIP-seq
MIRT1122101	hsa-miR-371b-5p	CLIP-seq
MIRT2390389	hsa-miR-4258	CLIP-seq
MIRT1122103	hsa-miR-4273	CLIP-seq
MIRT1122117	hsa-miR-513c	CLIP-seq
MIRT1122118	hsa-miR-514b-5p	CLIP-seq
MIRT2390390	hsa-miR-532-3p	CLIP-seq
MIRT2390391	hsa-miR-662	CLIP-seq
MIRT2453496	hsa-miR-296-5p	CLIP-seq
MIRT2453497	hsa-miR-3184	CLIP-seq
MIRT2453498	hsa-miR-423-5p	CLIP-seq
MIRT1122104	hsa-miR-4281	CLIP-seq
MIRT1122105	hsa-miR-4330	CLIP-seq
MIRT1122106	hsa-miR-4449	CLIP-seq
MIRT2453499	hsa-miR-4523	CLIP-seq
MIRT1122109	hsa-miR-4532	CLIP-seq
MIRT2453500	hsa-miR-4685-5p	CLIP-seq
MIRT2453501	hsa-miR-4733-3p	CLIP-seq
MIRT2453502	hsa-miR-4758-3p	CLIP-seq
MIRT1122115	hsa-miR-493	CLIP-seq
MIRT2453496	hsa-miR-296-5p	CLIP-seq
MIRT2453497	hsa-miR-3184	CLIP-seq
MIRT2453498	hsa-miR-423-5p	CLIP-seq
MIRT2453499	hsa-miR-4523	CLIP-seq
MIRT2453500	hsa-miR-4685-5p	CLIP-seq
MIRT2453501	hsa-miR-4733-3p	CLIP-seq
MIRT2453502	hsa-miR-4758-3p	CLIP-seq
MIRT2453496	hsa-miR-296-5p	CLIP-seq
MIRT2453497	hsa-miR-3184	CLIP-seq
MIRT2453498	hsa-miR-423-5p	CLIP-seq
MIRT2453499	hsa-miR-4523	CLIP-seq
MIRT2453500	hsa-miR-4685-5p	CLIP-seq
MIRT2453501	hsa-miR-4733-3p	CLIP-seq
MIRT2453502	hsa-miR-4758-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	TAS	8702478
GO:0001632	Function	Leukotriene B4 receptor activity	IBA
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004974	Function	Leukotriene receptor activity	IEA
GO:0004974	Function	Leukotriene receptor activity	TAS	9177352
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	9177352
GO:0006936	Process	Muscle contraction	TAS	8702478
GO:0006954	Process	Inflammatory response	TAS	9177352
GO:0006955	Process	Immune response	TAS	9177352
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS	9177352
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	TAS	8702478
GO:0007218	Process	Neuropeptide signaling pathway	IBA
GO:0008528	Function	G protein-coupled peptide receptor activity	IBA
GO:0016020	Component	Membrane	IEA
GO:0061737	Process	Leukotriene signaling pathway	IEA

Other IDs

• MIM: 601531
• HGNC: 6713
• e!Ensembl: ENSG00000213903

Protein

• UniProt ID: Q15722
• Protein name: Leukotriene B4 receptor 1 (LTB4-R 1) (LTB4-R1) (Chemoattractant receptor-like 1) (G-protein coupled receptor 16) (P2Y purinoceptor 7) (P2Y7)
• Protein function: Receptor for extracellular ATP > UTP and ADP. The activity of this receptor is mediated by G proteins which activate a phosphatidylinositol-calcium second messenger system. May be the cardiac P2Y receptor involved in the regulation of cardiac mu
• PDB: 7K15, 7VKT
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	35 → 285	7 transmembrane receptor (rhodopsin family)	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed at highest levels in heart, skeletal muscle and at lower levels in brain and liver. High level of expression in lymphoid tissues.
• Sequence:

  MNTTSSAAPPSLGVEFISLLAIILLSVALAVGLPGNSFVVWSILKRMQKRSVTALMVLNL
  ALADLAVLLTAPFFLHFLAQGTWSFGLAGCRLCHYVCGVSMYASVLLITAMSLDRSLAVA
  RPFVSQKLRTKAMARRVLAGIWVLSFLLATPVLAYRTVVPWKTNMSLCFPRYPSEGHRAF
  HLIFEAVTGFLLPFLAVVASYSDIGRRLQARRFRRSRRTGRLVVLIILTFAAFWLPYHVV
  NLAEAGRALAGQAAGLGLVGKRLSLARNVLIALAFLSSSVNPVLYACAGGGLLRSAGVGF
  VAKLLEGTGSEASSTRRGGSLGQTARSGPAALEPGPSESLTASSPLKLNELN

• Sequence length: 352

Pathways

KEGG:

Neuroactive ligand-receptor interaction

Reactome:

Leukotriene receptors
G alpha (q) signalling events

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ANAPHYLAXIS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEPHROSCLEROSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute pancreatitis	Pancreatitis	BEFREE	29482159		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	25486432		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	30232269		★☆☆☆☆ Found in Text Mining only
Allergic sensitization	Allergic Sensitization	BEFREE	30390302		★☆☆☆☆ Found in Text Mining only
Alopecia	Alopecia	BEFREE	28209904		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	31912564, 33788842	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm	Aortic Aneurysm	BEFREE	17579092		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	17579092		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	14656734, 17579092, 25480980, 29209564		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	Pubtator	16624877	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	20656922, 29042029, 29209564, 29602515		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	16179368, 19448154, 21596548, 22206291, 23167751, 25480980, 29042028		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	16179368, 24428972	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	LHGDN	17075244		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	14656734, 17579092, 25480980, 29209564		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	26696753	Associate	★☆☆☆☆ Found in Text Mining only
Blast Crisis	Blast crisis	Pubtator	19654405	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	26497676		★☆☆☆☆ Found in Text Mining only
Bronchiolitis Obliterans	Bronchiolitis Obliterans	BEFREE	15998790		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	20187983, 27475906	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	34814348	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	26696753, 33968297, 36429034	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	28982616		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	LHGDN	18323512		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	31564828		★☆☆☆☆ Found in Text Mining only
Ciliary Motility Disorders	Ciliary dyskinesia	Pubtator	29116124	Associate	★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	29670278		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	25486432		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	29209564		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	31085102		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	17220595	Associate	★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	7923869	Associate	★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	12913925		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	Pubtator	33788842	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	28108297		★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	20109744	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	18797182		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	30185672		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	30185672		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	32273829	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	31242337		★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	18797182		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	15996849		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	27475906		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	27475906		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	27475906	Stimulate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	28751450		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	28751450		★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	23869841, 24021673		★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	BEFREE	31242337		★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	19420076		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	29670278		★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	28108297		★☆☆☆☆ Found in Text Mining only
Intestinal Neoplasms	Intestinal Neoplasms	BEFREE	29382671		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	28318626, 31357612		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	27881485		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	29884308		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	26497676		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	27475906		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	29255459		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	20952510, 29255459		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	20600831		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	28982616		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	25486432		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	25193960		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	16689996		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	23271478, 28424683, 29653339, 29721395, 29884308, 31578272		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	25480980		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	18421027		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	20952510, 29255459		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	12163367		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	21993002		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	12163367	Associate	★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	32670289	Associate	★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	BEFREE	28355602		★☆☆☆☆ Found in Text Mining only
Peripheral Neuropathy	Peripheral Neuropathy	BEFREE	28355602		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	24169960	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	23859654, 28077599		★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	30818366		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	12913925, 29042029		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	12913925		★☆☆☆☆ Found in Text Mining only
Scleroderma	Scleroderma	BEFREE	29394994		★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	33949285	Associate	★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	34847389	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	20187983	Associate	★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	29394994		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	38139172	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	17579092		★☆☆☆☆ Found in Text Mining only