Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	1240
Gene name	Chemerin chemokine-like receptor 1
Gene symbol	CMKLR1
Synonyms (NCBI Gene)	CHEMERINRChemR23DEZERV1RVER1
Chromosome	12
Chromosome location	12q23.3

266

Show/Hide all (266)

miRTarBase ID	miRNA	Experiments	Reference
MIRT710975	hsa-miR-3127-3p	HITS-CLIP	19536157
MIRT710974	hsa-miR-6756-3p	HITS-CLIP	19536157
MIRT710973	hsa-miR-5088-3p	HITS-CLIP	19536157
MIRT710972	hsa-miR-3183	HITS-CLIP	19536157
MIRT710971	hsa-miR-4723-3p	HITS-CLIP	19536157
MIRT710970	hsa-miR-6769b-3p	HITS-CLIP	19536157
MIRT710969	hsa-miR-7110-3p	HITS-CLIP	19536157
MIRT710968	hsa-miR-6817-3p	HITS-CLIP	19536157
MIRT710967	hsa-miR-6515-3p	HITS-CLIP	19536157
MIRT710966	hsa-miR-1236-3p	HITS-CLIP	19536157
MIRT710965	hsa-miR-942-5p	HITS-CLIP	19536157
MIRT710964	hsa-miR-4778-3p	HITS-CLIP	19536157
MIRT710963	hsa-miR-6830-3p	HITS-CLIP	19536157
MIRT710962	hsa-miR-7111-3p	HITS-CLIP	19536157
MIRT710961	hsa-miR-6780a-3p	HITS-CLIP	19536157
MIRT710960	hsa-miR-6881-3p	HITS-CLIP	19536157
MIRT710959	hsa-miR-502-5p	HITS-CLIP	19536157
MIRT710958	hsa-miR-6873-3p	HITS-CLIP	19536157
MIRT710957	hsa-miR-511-5p	HITS-CLIP	19536157
MIRT710956	hsa-miR-4768-5p	HITS-CLIP	19536157
MIRT710955	hsa-miR-6833-3p	HITS-CLIP	19536157
MIRT710954	hsa-miR-6875-3p	HITS-CLIP	19536157
MIRT710953	hsa-miR-4659a-3p	HITS-CLIP	19536157
MIRT710952	hsa-miR-4659b-3p	HITS-CLIP	19536157
MIRT626466	hsa-miR-551b-5p	HITS-CLIP	23824327
MIRT626465	hsa-miR-6777-3p	HITS-CLIP	23824327
MIRT626464	hsa-miR-4301	HITS-CLIP	23824327
MIRT626463	hsa-miR-532-3p	HITS-CLIP	23824327
MIRT626462	hsa-miR-9-5p	HITS-CLIP	23824327
MIRT626461	hsa-miR-3156-3p	HITS-CLIP	23824327
MIRT626460	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT626459	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT626458	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT626457	hsa-miR-1269a	HITS-CLIP	23824327
MIRT626456	hsa-miR-1269b	HITS-CLIP	23824327
MIRT626455	hsa-miR-5009-5p	HITS-CLIP	23824327
MIRT626454	hsa-miR-8058	HITS-CLIP	23824327
MIRT626453	hsa-miR-4520-2-3p	HITS-CLIP	23824327
MIRT626452	hsa-miR-4529-3p	HITS-CLIP	23824327
MIRT626451	hsa-miR-7850-5p	HITS-CLIP	23824327
MIRT484041	hsa-miR-548m	PAR-CLIP	22012620
MIRT484040	hsa-miR-6758-3p	PAR-CLIP	22012620
MIRT484039	hsa-miR-627-3p	PAR-CLIP	22012620
MIRT484038	hsa-miR-4279	PAR-CLIP	22012620
MIRT484037	hsa-miR-629-3p	PAR-CLIP	22012620
MIRT484041	hsa-miR-548m	PAR-CLIP	23446348
MIRT484040	hsa-miR-6758-3p	PAR-CLIP	23446348
MIRT484039	hsa-miR-627-3p	PAR-CLIP	23446348
MIRT484038	hsa-miR-4279	PAR-CLIP	23446348
MIRT484037	hsa-miR-629-3p	PAR-CLIP	23446348
MIRT484041	hsa-miR-548m	PAR-CLIP	23592263
MIRT484040	hsa-miR-6758-3p	PAR-CLIP	23592263
MIRT484039	hsa-miR-627-3p	PAR-CLIP	23592263
MIRT484038	hsa-miR-4279	PAR-CLIP	23592263
MIRT484037	hsa-miR-629-3p	PAR-CLIP	23592263
MIRT484038	hsa-miR-4279	PAR-CLIP	26701625
MIRT484038	hsa-miR-4279	PAR-CLIP	26701625
MIRT484038	hsa-miR-4279	PAR-CLIP	26701625
MIRT484038	hsa-miR-4279	PAR-CLIP	26701625
MIRT484038	hsa-miR-4279	PAR-CLIP	26701625
MIRT484038	hsa-miR-4279	PAR-CLIP	26701625
MIRT484038	hsa-miR-4279	PAR-CLIP	26701625
MIRT484038	hsa-miR-4279	PAR-CLIP	26701625
MIRT484038	hsa-miR-4279	PAR-CLIP	26701625
MIRT484041	hsa-miR-548m	PAR-CLIP	26701625
MIRT484041	hsa-miR-548m	PAR-CLIP	26701625
MIRT484041	hsa-miR-548m	PAR-CLIP	26701625
MIRT484041	hsa-miR-548m	PAR-CLIP	26701625
MIRT484041	hsa-miR-548m	PAR-CLIP	26701625
MIRT484041	hsa-miR-548m	PAR-CLIP	26701625
MIRT484041	hsa-miR-548m	PAR-CLIP	26701625
MIRT484041	hsa-miR-548m	PAR-CLIP	26701625
MIRT484041	hsa-miR-548m	PAR-CLIP	26701625
MIRT484039	hsa-miR-627-3p	PAR-CLIP	26701625
MIRT484039	hsa-miR-627-3p	PAR-CLIP	26701625
MIRT484039	hsa-miR-627-3p	PAR-CLIP	26701625
MIRT484039	hsa-miR-627-3p	PAR-CLIP	26701625
MIRT484039	hsa-miR-627-3p	PAR-CLIP	26701625
MIRT484039	hsa-miR-627-3p	PAR-CLIP	26701625
MIRT484039	hsa-miR-627-3p	PAR-CLIP	26701625
MIRT484039	hsa-miR-627-3p	PAR-CLIP	26701625
MIRT484039	hsa-miR-627-3p	PAR-CLIP	26701625
MIRT484037	hsa-miR-629-3p	PAR-CLIP	26701625
MIRT484037	hsa-miR-629-3p	PAR-CLIP	26701625
MIRT484037	hsa-miR-629-3p	PAR-CLIP	26701625
MIRT484037	hsa-miR-629-3p	PAR-CLIP	26701625
MIRT484037	hsa-miR-629-3p	PAR-CLIP	26701625
MIRT484037	hsa-miR-629-3p	PAR-CLIP	26701625
MIRT484037	hsa-miR-629-3p	PAR-CLIP	26701625
MIRT484037	hsa-miR-629-3p	PAR-CLIP	26701625
MIRT484037	hsa-miR-629-3p	PAR-CLIP	26701625
MIRT484040	hsa-miR-6758-3p	PAR-CLIP	26701625
MIRT484040	hsa-miR-6758-3p	PAR-CLIP	26701625
MIRT484040	hsa-miR-6758-3p	PAR-CLIP	26701625
MIRT484040	hsa-miR-6758-3p	PAR-CLIP	26701625
MIRT484040	hsa-miR-6758-3p	PAR-CLIP	26701625
MIRT484040	hsa-miR-6758-3p	PAR-CLIP	26701625
MIRT484040	hsa-miR-6758-3p	PAR-CLIP	26701625
MIRT484040	hsa-miR-6758-3p	PAR-CLIP	26701625
MIRT484040	hsa-miR-6758-3p	PAR-CLIP	26701625
MIRT484038	hsa-miR-4279	PAR-CLIP	27292025
MIRT484038	hsa-miR-4279	PAR-CLIP	27292025
MIRT484038	hsa-miR-4279	PAR-CLIP	27292025
MIRT484038	hsa-miR-4279	PAR-CLIP	27292025
MIRT484038	hsa-miR-4279	PAR-CLIP	27292025
MIRT484041	hsa-miR-548m	PAR-CLIP	27292025
MIRT484041	hsa-miR-548m	PAR-CLIP	27292025
MIRT484041	hsa-miR-548m	PAR-CLIP	27292025
MIRT484041	hsa-miR-548m	PAR-CLIP	27292025
MIRT484041	hsa-miR-548m	PAR-CLIP	27292025
MIRT484039	hsa-miR-627-3p	PAR-CLIP	27292025
MIRT484039	hsa-miR-627-3p	PAR-CLIP	27292025
MIRT484039	hsa-miR-627-3p	PAR-CLIP	27292025
MIRT484039	hsa-miR-627-3p	PAR-CLIP	27292025
MIRT484039	hsa-miR-627-3p	PAR-CLIP	27292025
MIRT484037	hsa-miR-629-3p	PAR-CLIP	27292025
MIRT484037	hsa-miR-629-3p	PAR-CLIP	27292025
MIRT484037	hsa-miR-629-3p	PAR-CLIP	27292025
MIRT484037	hsa-miR-629-3p	PAR-CLIP	27292025
MIRT484037	hsa-miR-629-3p	PAR-CLIP	27292025
MIRT484040	hsa-miR-6758-3p	PAR-CLIP	27292025
MIRT484040	hsa-miR-6758-3p	PAR-CLIP	27292025
MIRT484040	hsa-miR-6758-3p	PAR-CLIP	27292025
MIRT484040	hsa-miR-6758-3p	PAR-CLIP	27292025
MIRT484040	hsa-miR-6758-3p	PAR-CLIP	27292025
MIRT710975	hsa-miR-3127-3p	HITS-CLIP	19536157
MIRT710974	hsa-miR-6756-3p	HITS-CLIP	19536157
MIRT710973	hsa-miR-5088-3p	HITS-CLIP	19536157
MIRT710972	hsa-miR-3183	HITS-CLIP	19536157
MIRT710971	hsa-miR-4723-3p	HITS-CLIP	19536157
MIRT710970	hsa-miR-6769b-3p	HITS-CLIP	19536157
MIRT710969	hsa-miR-7110-3p	HITS-CLIP	19536157
MIRT710968	hsa-miR-6817-3p	HITS-CLIP	19536157
MIRT710967	hsa-miR-6515-3p	HITS-CLIP	19536157
MIRT710966	hsa-miR-1236-3p	HITS-CLIP	19536157
MIRT710965	hsa-miR-942-5p	HITS-CLIP	19536157
MIRT710964	hsa-miR-4778-3p	HITS-CLIP	19536157
MIRT710963	hsa-miR-6830-3p	HITS-CLIP	19536157
MIRT710962	hsa-miR-7111-3p	HITS-CLIP	19536157
MIRT710961	hsa-miR-6780a-3p	HITS-CLIP	19536157
MIRT710960	hsa-miR-6881-3p	HITS-CLIP	19536157
MIRT710959	hsa-miR-502-5p	HITS-CLIP	19536157
MIRT710958	hsa-miR-6873-3p	HITS-CLIP	19536157
MIRT710957	hsa-miR-511-5p	HITS-CLIP	19536157
MIRT710956	hsa-miR-4768-5p	HITS-CLIP	19536157
MIRT710955	hsa-miR-6833-3p	HITS-CLIP	19536157
MIRT710954	hsa-miR-6875-3p	HITS-CLIP	19536157
MIRT710953	hsa-miR-4659a-3p	HITS-CLIP	19536157
MIRT710952	hsa-miR-4659b-3p	HITS-CLIP	19536157
MIRT626466	hsa-miR-551b-5p	HITS-CLIP	23824327
MIRT626465	hsa-miR-6777-3p	HITS-CLIP	23824327
MIRT626464	hsa-miR-4301	HITS-CLIP	23824327
MIRT626463	hsa-miR-532-3p	HITS-CLIP	23824327
MIRT626462	hsa-miR-9-5p	HITS-CLIP	23824327
MIRT626461	hsa-miR-3156-3p	HITS-CLIP	23824327
MIRT626460	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT626459	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT626458	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT626457	hsa-miR-1269a	HITS-CLIP	23824327
MIRT626456	hsa-miR-1269b	HITS-CLIP	23824327
MIRT626455	hsa-miR-5009-5p	HITS-CLIP	23824327
MIRT626454	hsa-miR-8058	HITS-CLIP	23824327
MIRT626453	hsa-miR-4520-2-3p	HITS-CLIP	23824327
MIRT626452	hsa-miR-4529-3p	HITS-CLIP	23824327
MIRT626451	hsa-miR-7850-5p	HITS-CLIP	23824327
MIRT484041	hsa-miR-548m	PAR-CLIP	22012620
MIRT484040	hsa-miR-6758-3p	PAR-CLIP	22012620
MIRT484039	hsa-miR-627-3p	PAR-CLIP	22012620
MIRT484038	hsa-miR-4279	PAR-CLIP	22012620
MIRT484037	hsa-miR-629-3p	PAR-CLIP	22012620
MIRT484041	hsa-miR-548m	PAR-CLIP	23446348
MIRT484040	hsa-miR-6758-3p	PAR-CLIP	23446348
MIRT484039	hsa-miR-627-3p	PAR-CLIP	23446348
MIRT484038	hsa-miR-4279	PAR-CLIP	23446348
MIRT484037	hsa-miR-629-3p	PAR-CLIP	23446348
MIRT484041	hsa-miR-548m	PAR-CLIP	23592263
MIRT484040	hsa-miR-6758-3p	PAR-CLIP	23592263
MIRT484039	hsa-miR-627-3p	PAR-CLIP	23592263
MIRT484038	hsa-miR-4279	PAR-CLIP	23592263
MIRT484037	hsa-miR-629-3p	PAR-CLIP	23592263
MIRT898646	hsa-miR-1270	CLIP-seq
MIRT898647	hsa-miR-127-5p	CLIP-seq
MIRT898648	hsa-miR-1299	CLIP-seq
MIRT898649	hsa-miR-23a	CLIP-seq
MIRT898650	hsa-miR-23b	CLIP-seq
MIRT898651	hsa-miR-23c	CLIP-seq
MIRT898652	hsa-miR-4683	CLIP-seq
MIRT898653	hsa-miR-4717-3p	CLIP-seq
MIRT898654	hsa-miR-4782-5p	CLIP-seq
MIRT898655	hsa-miR-516b	CLIP-seq
MIRT898656	hsa-miR-620	CLIP-seq
MIRT898657	hsa-miR-1253	CLIP-seq
MIRT898658	hsa-miR-4323	CLIP-seq
MIRT898659	hsa-miR-4758-3p	CLIP-seq
MIRT898660	hsa-miR-524-3p	CLIP-seq
MIRT898661	hsa-miR-525-3p	CLIP-seq
MIRT898662	hsa-miR-106a	CLIP-seq
MIRT898663	hsa-miR-106b	CLIP-seq
MIRT898664	hsa-miR-1207-5p	CLIP-seq
MIRT898665	hsa-miR-1224-3p	CLIP-seq
MIRT898666	hsa-miR-1260	CLIP-seq
MIRT898667	hsa-miR-1260b	CLIP-seq
MIRT898668	hsa-miR-1280	CLIP-seq
MIRT898669	hsa-miR-150	CLIP-seq
MIRT898670	hsa-miR-17	CLIP-seq
MIRT898671	hsa-miR-1827	CLIP-seq
MIRT898672	hsa-miR-20a	CLIP-seq
MIRT898673	hsa-miR-20b	CLIP-seq
MIRT898674	hsa-miR-3155	CLIP-seq
MIRT898675	hsa-miR-3155b	CLIP-seq
MIRT898676	hsa-miR-3163	CLIP-seq
MIRT898677	hsa-miR-3184	CLIP-seq
MIRT898678	hsa-miR-3609	CLIP-seq
MIRT898679	hsa-miR-3612	CLIP-seq
MIRT898680	hsa-miR-361-3p	CLIP-seq
MIRT898681	hsa-miR-3689d	CLIP-seq
MIRT898682	hsa-miR-380	CLIP-seq
MIRT898683	hsa-miR-423-5p	CLIP-seq
MIRT898684	hsa-miR-4266	CLIP-seq
MIRT898685	hsa-miR-4300	CLIP-seq
MIRT898686	hsa-miR-4312	CLIP-seq
MIRT898687	hsa-miR-4459	CLIP-seq
MIRT898688	hsa-miR-4495	CLIP-seq
MIRT898689	hsa-miR-450b-5p	CLIP-seq
MIRT898690	hsa-miR-4645-5p	CLIP-seq
MIRT898691	hsa-miR-4673	CLIP-seq
MIRT898692	hsa-miR-4688	CLIP-seq
MIRT898693	hsa-miR-4695-5p	CLIP-seq
MIRT898694	hsa-miR-4713-5p	CLIP-seq
MIRT898695	hsa-miR-4726-3p	CLIP-seq
MIRT898696	hsa-miR-4761-5p	CLIP-seq
MIRT898697	hsa-miR-4763-3p	CLIP-seq
MIRT898698	hsa-miR-4779	CLIP-seq
MIRT898699	hsa-miR-4796-3p	CLIP-seq
MIRT898700	hsa-miR-484	CLIP-seq
MIRT898701	hsa-miR-507	CLIP-seq
MIRT898702	hsa-miR-519a	CLIP-seq
MIRT898703	hsa-miR-519b-3p	CLIP-seq
MIRT898704	hsa-miR-519c-3p	CLIP-seq
MIRT898705	hsa-miR-519d	CLIP-seq
MIRT898706	hsa-miR-548ah	CLIP-seq
MIRT898707	hsa-miR-557	CLIP-seq
MIRT898708	hsa-miR-583	CLIP-seq
MIRT898709	hsa-miR-650	CLIP-seq
MIRT898710	hsa-miR-665	CLIP-seq
MIRT898711	hsa-miR-920	CLIP-seq
MIRT898712	hsa-miR-93	CLIP-seq
MIRT898713	hsa-miR-940	CLIP-seq
MIRT898714	hsa-miR-942	CLIP-seq
MIRT1922665	hsa-miR-204	CLIP-seq
MIRT1922666	hsa-miR-211	CLIP-seq
MIRT1966448	hsa-miR-188-5p	CLIP-seq
MIRT898655	hsa-miR-516b	CLIP-seq
MIRT2202304	hsa-miR-766	CLIP-seq
MIRT2386257	hsa-miR-205	CLIP-seq
MIRT2386258	hsa-miR-3192	CLIP-seq
MIRT2386259	hsa-miR-3194-3p	CLIP-seq
MIRT2386260	hsa-miR-326	CLIP-seq
MIRT2386261	hsa-miR-330-5p	CLIP-seq
MIRT2386262	hsa-miR-4314	CLIP-seq
MIRT2386263	hsa-miR-4646-5p	CLIP-seq
MIRT898676	hsa-miR-3163	CLIP-seq
MIRT2505186	hsa-miR-1289	CLIP-seq
MIRT2505187	hsa-miR-4267	CLIP-seq
MIRT2505186	hsa-miR-1289	CLIP-seq
MIRT2505187	hsa-miR-4267	CLIP-seq

Show/Hide all (43)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001501	Process	Skeletal system development	TAS	9144535
GO:0002430	Process	Complement receptor mediated signaling pathway	IBA
GO:0004875	Function	Complement receptor activity	IBA
GO:0004930	Function	G protein-coupled receptor activity	IBA
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004930	Function	G protein-coupled receptor activity	NAS	9603476
GO:0004950	Function	Chemokine receptor activity	TAS	9425281
GO:0005515	Function	Protein binding	IPI	14530373
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	14530373, 27716822
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	9425281
GO:0006935	Process	Chemotaxis	IBA
GO:0006935	Process	Chemotaxis	IDA	14530373
GO:0006935	Process	Chemotaxis	TAS	9425281
GO:0006954	Process	Inflammatory response	IBA
GO:0006955	Process	Immune response	TAS	9425281
GO:0007154	Process	Cell communication	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IDA	14530373, 27716822
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	NAS	9603476
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS	9425281
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	IBA
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IBA
GO:0010759	Process	Positive regulation of macrophage chemotaxis	IBA
GO:0010759	Process	Positive regulation of macrophage chemotaxis	IMP	19443732
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	NAS	9603476
GO:0023052	Process	Signaling	IEA
GO:0032088	Process	Negative regulation of NF-kappaB transcription factor activity	IDA	15753205
GO:0032695	Process	Negative regulation of interleukin-12 production	IEA
GO:0032695	Process	Negative regulation of interleukin-12 production	ISS
GO:0038023	Function	Signaling receptor activity	TAS	9144535
GO:0045600	Process	Positive regulation of fat cell differentiation	IEA
GO:0045600	Process	Positive regulation of fat cell differentiation	ISS
GO:0050848	Process	Regulation of calcium-mediated signaling	IBA
GO:0050848	Process	Regulation of calcium-mediated signaling	IDA	14530373
GO:0070098	Process	Chemokine-mediated signaling pathway	IEA
GO:0097003	Function	Adipokinetic hormone receptor activity	IDA	27716822
GO:0097004	Function	Adipokinetic hormone binding	IDA	27716822
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	IEA
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	ISS	26972253

MIM	HGNC	e!Ensembl
602351	2121	ENSG00000174600

Q99788

Protein name

Chemerin-like receptor 1 (Chemokine-like receptor 1) (G-protein coupled receptor ChemR23) (G-protein coupled receptor DEZ)

Protein function

Receptor for the chemoattractant adipokine chemerin/RARRES2 and for the omega-3 fatty acid derived molecule resolvin E1. Interaction with RARRES2 initiates activation of G proteins G(i)/G(o) and beta-arrestin pathways inducing cellular responses

PDB

7YKD , 8SG1 , 8ZJG , 9L3W

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	57 → 316	7 transmembrane receptor (rhodopsin family)	Family

Tissue specificity

TISSUE SPECIFICITY: Prominently expressed in developing osseous and cartilaginous tissue. Also found in adult parathyroid glands. Expressed in cardiovascular system, brain, kidney, gastrointestinal tissues and myeloid tissues. Expressed in a broad array o

Sequence

MRMEDEDYNTSISYGDEYPDYLDSIVVLEDLSPLEARVTRIFLVVVYSIVCFLGILGNGL
VIIIATFKMKKTVNMVWFLNLAVADFLFNVFLPIHITYAAMDYHWVFGTAMCKISNFLLI
HNMFTSVFLLTIISSDRCISVLLPVWSQNHRSVRLAYMACMVIWVLAFFLSSPSLVFRDT
ANLHGKISCFNNFSLSTPGSSSWPTHSQMDPVGYSRHMVVTVTRFLCGFLVPVLIITACY
LTIVCKLQRNRLAKTKKPFKIIVTIIITFFLCWCPYHTLNLLELHHTAMPGSVFSLGLPL
ATALAIANSCMNPILYVFMGQDFKKFKVALFSRLVNALSEDTGHSSYPSHRSFTKMSSMN
ERTSMNERETGML

Sequence length

373

Interactions

View interactions

	Reactome
			Class A/1 (Rhodopsin-like receptors)

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (8)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ANDROGENETIC ALOPECIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ERECTILE DYSFUNCTION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
JUVENILE IDIOPATHIC ARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRE-ECLAMPSIA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (69)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Alzheimer Disease	Alzheimer disease	Pubtator	31912564	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	29739755, 30786742		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	30576947		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Reactive	Reactive arthritis	Pubtator	24689495	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	21959042, 33508012	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	24779513	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	29739755, 30786742		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	31073181, 31521459		★★★★★ ★☆☆☆☆ Found in Text Mining only
Borderline Personality Disorder	Borderline personality disorder	BEFREE	22675514		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	31588246		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	22675514		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	30597013, 31197872		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chylomicron retention disease	Chylomicron retention disease	Pubtator	21483023	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	34946244	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	22037282, 27860453		★★★★★ ★☆☆☆☆ Found in Text Mining only
Demyelinating Diseases	Demyelinating Diseases	BEFREE	31073181		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	PSYGENET_DG	22796467		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	BEFREE	29090333		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes	Diabetes	BEFREE	30126255, 30216119, 30873215		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	30126255, 30216119, 30873215		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	27548138	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	27994073	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	27548138, 27994073, 28625137, 29682177, 30216119		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	30784180		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	34318471	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	22118966, 28905319		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver Alcoholic	Fatty liver, alcoholic	Pubtator	27548138	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	27548138, 29715085		★★★★★ ★☆☆☆☆ Found in Text Mining only
Granulosa Cell Cancer	Granulosa Cell Tumor	CTD_human_DG	29653259		★★★★★ ★☆☆☆☆ Found in Text Mining only
granulosa cell tumor	Granulosa Cell Tumor	BEFREE	29653259		★★★★★ ★☆☆☆☆ Found in Text Mining only
granulosa cell tumor	Granulosa Cell Tumor	CTD_human_DG	29653259		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis C Chronic	Hepatitis c	Pubtator	25121101	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	28993702		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	30595125, 30972165, 31835675		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxic-Ischemic Encephalopathy	Hypoxic-Ischemic Encephalopathy	BEFREE	30718467		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	31588246		★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	31733653		★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	27239101, 33508012	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
LEPTIN DEFICIENCY OR DYSFUNCTION	LEPTIN DEFICIENCY OR DYSFUNCTION	BEFREE	29414326		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	29715085		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	28619829	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	31521459		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	21346723		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	31588246, 31840972		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	28625137, 29221117, 31803622		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	31063220		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	PSYGENET_DG	22796467		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	BEFREE	29090333		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	31835675		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	31073181		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	22753924, 28114280, 29221117, 29715085, 31063220, 31561459, 31588246		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	29221117		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	22118966, 23935128, 27548138		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	GWASCAT_DG	21483023		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	27548138, 28600126		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	17640997, 23935128, 29146976, 29279348, 29682177, 30257454, 30722991, 30873215		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	27239101	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	28233070		★★★★★ ★☆☆☆☆ Found in Text Mining only
POROKERATOSIS, DISSEMINATED SUPERFICIAL ACTINIC, 1	Porokeratosis	BEFREE	15149516		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pseudohyperkalemia Cardiff	Pseudohyperkalemia Cardiff	BEFREE	25121101		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	19114666, 31521459		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	19114666	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	30126255		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	22037282		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	34847389	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	BEFREE	31803622		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	39183397	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	22118966, 28905319		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular System Injuries	Vascular system injury	Pubtator	34946244	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

CMKLR1 (chemerin chemokine-like receptor 1)