NRN1L (neuritin 1 like)

Gene

• Entrez ID: 123904
• Gene name: Neuritin 1 like
• Gene symbol: NRN1L
• Synonyms (NCBI Gene): MRCC2446, UNQ2446, cpg15-2
• Chromosome: 16
• Chromosome location: 16q22.1
• Summary: The protein encoded by this gene is extracellular and enhances both neurite growth and neuronal survival. The encoded protein is found both as a GPI anchored membrane-bound form and as a secreted form. This activity-related ligand functions as a homodimer

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1194338	hsa-miR-1254	CLIP-seq
MIRT1194339	hsa-miR-3116	CLIP-seq
MIRT1194340	hsa-miR-3690	CLIP-seq
MIRT1194341	hsa-miR-4638-3p	CLIP-seq
MIRT2056406	hsa-miR-2278	CLIP-seq
MIRT2056407	hsa-miR-3135b	CLIP-seq
MIRT2056408	hsa-miR-3652	CLIP-seq
MIRT2056409	hsa-miR-3689d	CLIP-seq
MIRT2056410	hsa-miR-4430	CLIP-seq
MIRT2056411	hsa-miR-4446-3p	CLIP-seq
MIRT2056412	hsa-miR-4492	CLIP-seq
MIRT2056413	hsa-miR-4498	CLIP-seq
MIRT2056414	hsa-miR-762	CLIP-seq
MIRT2582818	hsa-miR-1184	CLIP-seq
MIRT2582819	hsa-miR-1205	CLIP-seq
MIRT2582820	hsa-miR-3158-5p	CLIP-seq
MIRT2582821	hsa-miR-3173-5p	CLIP-seq
MIRT2582822	hsa-miR-3194-3p	CLIP-seq
MIRT2582823	hsa-miR-370	CLIP-seq
MIRT2582818	hsa-miR-1184	CLIP-seq
MIRT2582819	hsa-miR-1205	CLIP-seq
MIRT2582820	hsa-miR-3158-5p	CLIP-seq
MIRT2582821	hsa-miR-3173-5p	CLIP-seq
MIRT2582822	hsa-miR-3194-3p	CLIP-seq
MIRT2582823	hsa-miR-370	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0007399	Process	Nervous system development	IEA
GO:0016020	Component	Membrane	IEA
GO:0030424	Component	Axon	IEA
GO:0042802	Function	Identical protein binding	IEA
GO:0098552	Component	Side of membrane	IEA
GO:1990138	Process	Neuron projection extension	IBA
GO:1990138	Process	Neuron projection extension	IEA

Other IDs

• MIM: HGNC
• HGNC: N/A
• e!Ensembl: HGNC

Protein

• UniProt ID: Q496H8
• Protein name: Neuritin-like protein
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF15056	NRN1	42 → 120	Neuritin protein family	Domain

• Sequence:

  MMRCCRRRCCCRQPPHALRPLLLLPLVLLPPLAAAAAGPNRCDTIYQGFAECLIRLGDSM
  GRGGELETICRSWNDFHACASQVLSGCPEEAAAVWESLQQEARQAPRPNNLHTLCGAPVH
  VRERGTGSETNQETLRATAPALPMAPAPPLLAAALALAYLLRPLA

• Sequence length: 165

Pathways

Reactome:

Post-translational modification: synthesis of GPI-anchored proteins

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
GOUT	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations