ACKR2 (atypical chemokine receptor 2)

Gene

• Entrez ID: 1238
• Gene name: Atypical chemokine receptor 2
• Gene symbol: ACKR2
• Synonyms (NCBI Gene): CCBP2, CCR10, CCR9, CMKBR9, D6, hD6
• Chromosome: 3
• Chromosome location: 3p22.1
• Summary: This gene encodes a beta chemokine receptor, which is predicted to be a seven transmembrane protein similar to G protein-coupled receptors. Chemokines and their receptor-mediated signal transduction are critical for the recruitment of effector immune cell

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT742159	hsa-miR-548c-3p	HITS-CLIP	23824327
MIRT742160	hsa-miR-551b-5p	HITS-CLIP	23824327
MIRT742161	hsa-miR-3613-3p	HITS-CLIP	23824327
MIRT742162	hsa-miR-2116-5p	HITS-CLIP	23824327
MIRT742163	hsa-miR-22-5p	HITS-CLIP	23824327
MIRT742164	hsa-miR-4273	HITS-CLIP	23824327
MIRT742165	hsa-miR-7156-5p	HITS-CLIP	23824327
MIRT742166	hsa-miR-4677-5p	HITS-CLIP	23824327
MIRT742167	hsa-miR-375	HITS-CLIP	23824327
MIRT742168	hsa-miR-6739-3p	HITS-CLIP	23824327
MIRT742169	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT742159	hsa-miR-548c-3p	HITS-CLIP	23824327
MIRT742160	hsa-miR-551b-5p	HITS-CLIP	23824327
MIRT742169	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT742159	hsa-miR-548c-3p	HITS-CLIP	23824327
MIRT742160	hsa-miR-551b-5p	HITS-CLIP	23824327
MIRT742167	hsa-miR-375	HITS-CLIP	23824327
MIRT742168	hsa-miR-6739-3p	HITS-CLIP	23824327
MIRT742169	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT755176	hsa-miR-552-3p	PAR-CLIP	23592263
MIRT755177	hsa-miR-3200-5p	PAR-CLIP	23592263
MIRT755178	hsa-miR-125a-3p	PAR-CLIP	23592263
MIRT755179	hsa-miR-5681a	PAR-CLIP	23592263
MIRT755180	hsa-miR-6730-5p	PAR-CLIP	23592263
MIRT755181	hsa-miR-1236-5p	PAR-CLIP	23592263
MIRT755182	hsa-miR-4765	PAR-CLIP	23592263
MIRT755183	hsa-miR-488-3p	PAR-CLIP	23592263
MIRT755184	hsa-miR-4520-3p	PAR-CLIP	23592263
MIRT755185	hsa-miR-4520-2-3p	PAR-CLIP	23592263

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004950	Function	Chemokine receptor activity	IDA	9364936
GO:0004950	Function	Chemokine receptor activity	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005654	Component	Nucleoplasm	IDA
GO:0005768	Component	Endosome	IEA
GO:0005769	Component	Early endosome	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005884	Component	Actin filament	IDA	23633677
GO:0005886	Component	Plasma membrane	IDA	23633677
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	9364936
GO:0006935	Process	Chemotaxis	IEA
GO:0006954	Process	Inflammatory response	IEA
GO:0006955	Process	Immune response	IBA
GO:0007165	Process	Signal transduction	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IBA
GO:0009897	Component	External side of plasma membrane	IBA
GO:0016020	Component	Membrane	IEA
GO:0016493	Function	C-C chemokine receptor activity	IBA
GO:0016493	Function	C-C chemokine receptor activity	IEA
GO:0019722	Process	Calcium-mediated signaling	IBA
GO:0019957	Function	C-C chemokine binding	IBA
GO:0019957	Function	C-C chemokine binding	IEA
GO:0031965	Component	Nuclear membrane	IDA
GO:0035556	Process	Intracellular signal transduction	TAS	9364936
GO:0055037	Component	Recycling endosome	IEA
GO:0060326	Process	Cell chemotaxis	IBA
GO:0070098	Process	Chemokine-mediated signaling pathway	IEA
GO:0140319	Function	Receptor decoy activity	IDA	18201974
GO:0140319	Function	Receptor decoy activity	IMP	23633677

Other IDs

• MIM: 602648
• HGNC: 1565
• e!Ensembl: ENSG00000144648

Protein

• UniProt ID: O00590
• Protein name: Atypical chemokine receptor 2 (C-C chemokine receptor D6) (Chemokine receptor CCR-10) (Chemokine receptor CCR-9) (Chemokine-binding protein 2) (Chemokine-binding protein D6)
• Protein function: Atypical chemokine receptor that controls chemokine levels and localization via high-affinity chemokine binding that is uncoupled from classic ligand-driven signal transduction cascades, resulting instead in chemokine sequestration, degradation,
• PDB: 8GO9, 8J8V, 8J8Z
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	63 → 312	7 transmembrane receptor (rhodopsin family)	Family

• Tissue specificity: TISSUE SPECIFICITY: Found in endothelial cells lining afferent lymphatics in dermis and lymph nodes. Also found in lymph nodes subcapsular and medullary sinuses, tonsillar lymphatic sinuses and lymphatics in mucosa and submucosa of small and large intesti
• Sequence:

  MAATASPQPLATEDADSENSSFYYYDYLDEVAFMLCRKDAVVSFGKVFLPVFYSLIFVLG
  LSGNLLLLMVLLRYVPRRRMVEIYLLNLAISNLLFLVTLPFWGISVAWHWVFGSFLCKMV
  STLYTINFYSGIFFISCMSLDKYLEIVHAQPYHRLRTRAKSLLLATIVWAVSLAVSIPDM
  VFVQTHENPKGVWNCHADFGGHGTIWKLFLRFQQNLLGFLLPLLAMIFFYSRIGCVLVRL
  RPAGQGRALKIAAALVVAFFVLWFPYNLTLFLHTLLDLQVFGNCEVSQHLDYALQVTESI
  AFLHCCFSPILYAFSSHRFRQYLKAFLAAVLGWHLAPGTAQASLSSCSESSILTAQEEMT
  GMNDLGERQSENYPNKEDVGNKSA

• Sequence length: 384

Pathways

Reactome:

Chemokine receptors bind chemokines

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Alzheimer`s Disease	Alzheimer disease	GWASCAT_DG	25340798		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	28486662		★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	37131254	Stimulate	★☆☆☆☆ Found in Text Mining only
Arthropathy	Arthropathy	BEFREE	28486662		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	24260134, 30358125, 30850359		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	26314842, 30358125	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	30448408		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	33374792	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	33374792	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	23314186		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	23314186		★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	23314186	Associate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	23314186		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	17709525		★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	27568525		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	26798651		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	26798651		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	26798651		★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	BEFREE	29395335, 29571448		★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	27568525		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	30448408		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	30448408		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	37056937	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	30358125	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	24260134, 30358125, 30850359		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	19082487, 28123388		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	18708360		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	29445158		★☆☆☆☆ Found in Text Mining only
Migraine without Aura	Migraine	Pubtator	28486662	Stimulate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	29176798, 31770664		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	29382671, 29550065		★☆☆☆☆ Found in Text Mining only
Nephritis	Nephritis	BEFREE	29395335		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	30738810		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteopenia	Osteopenia	BEFREE	28476575		★☆☆☆☆ Found in Text Mining only
Psoriasiform eczema	Psoriasiform eczema	BEFREE	28010760		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	27568525, 28010760, 29279330		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	28486662, 37131254	Stimulate	★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	29469612		★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	30448408		★☆☆☆☆ Found in Text Mining only
Renal tubular disorder	Renal Tubular Disorder	BEFREE	30448408		★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	29589840		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	29550065		★★☆☆☆ Found in Text Mining + Unknown/Other Associations