CCR7 (C-C motif chemokine receptor 7)

Gene

• Entrez ID: 1236
• Gene name: C-C motif chemokine receptor 7
• Gene symbol: CCR7
• Synonyms (NCBI Gene): BLR2, CC-CKR-7, CCR-7, CD197, CDw197, CMKBR7, EBI1
• Chromosome: 17
• Chromosome location: 17q21.2
• Summary: The protein encoded by this gene is a member of the G protein-coupled receptor family. This receptor was identified as a gene induced by the Epstein-Barr virus (EBV), and is thought to be a mediator of EBV effects on B lymphocytes. This receptor is expres

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT006813	hsa-let-7a-5p	Luciferase reporter assay, Northern blot, qRT-PCR, Western blot	22251626
MIRT018216	hsa-miR-335-5p	Microarray	18185580
MIRT440980	hsa-miR-21-5p	HITS-CLIP	22473208
MIRT440980	hsa-miR-21-5p	HITS-CLIP	22473208
MIRT732313	hsa-miR-199a-5p	Luciferase reporter assay, qRT-PCR	27814720
MIRT732313	hsa-miR-199a-5p	Luciferase reporter assay, qRT-PCR	27814720
MIRT732697	hsa-let-7e-5p	Luciferase reporter assay, qRT-PCR	33630421
MIRT732697	hsa-let-7e-5p	Luciferase reporter assay, qRT-PCR	33630421
MIRT440980	hsa-miR-21-5p	Luciferase reporter assay, qRT-PCR, Western blotting	31813289
MIRT873274	hsa-miR-1207-3p	CLIP-seq
MIRT873275	hsa-miR-1271	CLIP-seq
MIRT873276	hsa-miR-129-5p	CLIP-seq
MIRT873277	hsa-miR-146b-3p	CLIP-seq
MIRT873278	hsa-miR-182	CLIP-seq
MIRT873279	hsa-miR-1827	CLIP-seq
MIRT873280	hsa-miR-3176	CLIP-seq
MIRT873281	hsa-miR-3185	CLIP-seq
MIRT873282	hsa-miR-3186-3p	CLIP-seq
MIRT873283	hsa-miR-339-5p	CLIP-seq
MIRT873284	hsa-miR-3612	CLIP-seq
MIRT873285	hsa-miR-361-5p	CLIP-seq
MIRT873286	hsa-miR-3922-3p	CLIP-seq
MIRT873287	hsa-miR-432	CLIP-seq
MIRT873288	hsa-miR-4421	CLIP-seq
MIRT873289	hsa-miR-4443	CLIP-seq
MIRT873290	hsa-miR-4690-3p	CLIP-seq
MIRT873291	hsa-miR-511	CLIP-seq
MIRT873292	hsa-miR-650	CLIP-seq
MIRT873293	hsa-miR-658	CLIP-seq
MIRT873294	hsa-miR-765	CLIP-seq
MIRT873295	hsa-miR-96	CLIP-seq
MIRT873281	hsa-miR-3185	CLIP-seq
MIRT873287	hsa-miR-432	CLIP-seq
MIRT873289	hsa-miR-4443	CLIP-seq
MIRT2196043	hsa-miR-548ad	CLIP-seq
MIRT873294	hsa-miR-765	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
EPAS1	Activation	19305150
HIF1A	Activation	17178876;19305150
KLF2	Unknown	20146713
NFKB1	Activation	11830455;19164127
NFKB1	Unknown	22158872
RELA	Activation	11830455;19164127
RELA	Unknown	22158872
TRERF1	Unknown	17006331

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001768	Process	Establishment of T cell polarity	IC	12729902
GO:0001954	Process	Positive regulation of cell-matrix adhesion	IC	15569314
GO:0002407	Process	Dendritic cell chemotaxis	IC	15778365
GO:0002408	Process	Myeloid dendritic cell chemotaxis	IDA	11602640, 14592837
GO:0002606	Process	Positive regulation of dendritic cell antigen processing and presentation	IEA
GO:0002606	Process	Positive regulation of dendritic cell antigen processing and presentation	ISS
GO:0002885	Process	Positive regulation of hypersensitivity	IEA
GO:0002885	Process	Positive regulation of hypersensitivity	ISS
GO:0002922	Process	Positive regulation of humoral immune response	IEA
GO:0002922	Process	Positive regulation of humoral immune response	ISS
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004930	Function	G protein-coupled receptor activity	TAS	16621978
GO:0004950	Function	Chemokine receptor activity	IEA
GO:0005739	Component	Mitochondrion	IDA
GO:0005886	Component	Plasma membrane	IDA	21051556
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006935	Process	Chemotaxis	IEA
GO:0006935	Process	Chemotaxis	IEA
GO:0006954	Process	Inflammatory response	IEA
GO:0006954	Process	Inflammatory response	NAS	14592837
GO:0006955	Process	Immune response	IBA
GO:0006955	Process	Immune response	IEA
GO:0006955	Process	Immune response	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS	16621978
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IBA
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	TAS	9153236
GO:0009897	Component	External side of plasma membrane	IBA
GO:0009897	Component	External side of plasma membrane	IEA
GO:0009986	Component	Cell surface	IDA	18308860
GO:0009986	Component	Cell surface	IEA
GO:0016020	Component	Membrane	IEA
GO:0016493	Function	C-C chemokine receptor activity	IEA
GO:0016493	Function	C-C chemokine receptor activity	ISS
GO:0019722	Process	Calcium-mediated signaling	IBA
GO:0030838	Process	Positive regulation of actin filament polymerization	IC	11242036
GO:0031274	Process	Positive regulation of pseudopodium assembly	IC	11242036
GO:0031529	Process	Ruffle organization	IC	15569314
GO:0032489	Process	Regulation of Cdc42 protein signal transduction	IEA
GO:0032489	Process	Regulation of Cdc42 protein signal transduction	ISS
GO:0032496	Process	Response to lipopolysaccharide	IEA
GO:0032649	Process	Regulation of type II interferon production	IEA
GO:0032649	Process	Regulation of type II interferon production	ISS
GO:0032651	Process	Regulation of interleukin-1 beta production	IEA
GO:0032651	Process	Regulation of interleukin-1 beta production	ISS
GO:0032695	Process	Negative regulation of interleukin-12 production	IEA
GO:0032695	Process	Negative regulation of interleukin-12 production	ISS
GO:0032735	Process	Positive regulation of interleukin-12 production	IEA
GO:0032735	Process	Positive regulation of interleukin-12 production	ISS
GO:0035022	Process	Positive regulation of Rac protein signal transduction	IEA
GO:0035022	Process	Positive regulation of Rac protein signal transduction	ISS
GO:0035757	Function	Chemokine (C-C motif) ligand 19 binding	IBA
GO:0035757	Function	Chemokine (C-C motif) ligand 19 binding	IPI	9507024
GO:0035758	Function	Chemokine (C-C motif) ligand 21 binding	IBA
GO:0035758	Function	Chemokine (C-C motif) ligand 21 binding	IPI	9507024
GO:0038117	Function	C-C motif chemokine 19 receptor activity	IBA
GO:0038117	Function	C-C motif chemokine 19 receptor activity	IDA	9507024
GO:0038119	Process	CCL19-activated CCR7 signaling pathway	IDA	14592837
GO:0038119	Process	CCL19-activated CCR7 signaling pathway	IEA
GO:0038120	Process	CCL21-activated CCR7 signaling pathway	IDA	14592837
GO:0038121	Function	C-C motif chemokine 21 receptor activity	IDA	9507024
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IC	15059845
GO:0045060	Process	Negative thymic T cell selection	IEA
GO:0045785	Process	Positive regulation of cell adhesion	IC	15569314
GO:0046330	Process	Positive regulation of JNK cascade	IC	15778365
GO:0048260	Process	Positive regulation of receptor-mediated endocytosis	IEA
GO:0048260	Process	Positive regulation of receptor-mediated endocytosis	ISS
GO:0048872	Process	Homeostasis of number of cells	IEA
GO:0050862	Process	Positive regulation of T cell receptor signaling pathway	IEA
GO:0051209	Process	Release of sequestered calcium ion into cytosol	IDA	14592837
GO:0051491	Process	Positive regulation of filopodium assembly	IC	15569314
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IC	15059845, 15778365
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IDA	14592837
GO:0060326	Process	Cell chemotaxis	IBA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IC	12729902, 15778365
GO:0071345	Process	Cellular response to cytokine stimulus	IDA	11602640
GO:0071380	Process	Cellular response to prostaglandin E stimulus	IDA	14592837
GO:0071731	Process	Response to nitric oxide	IC	16249377
GO:0090023	Process	Positive regulation of neutrophil chemotaxis	IDA	21051556
GO:0090023	Process	Positive regulation of neutrophil chemotaxis	IEA
GO:0097022	Process	Lymphocyte migration into lymph node	TAS	18379575
GO:0097029	Process	Mature conventional dendritic cell differentiation	IEA
GO:0097029	Process	Mature conventional dendritic cell differentiation	ISS
GO:0141214	Process	Positive regulation of phospholipase C/protein kinase C signal transduction	IDA	14592837
GO:2000147	Process	Positive regulation of cell motility	IC	15778365
GO:2000510	Process	Positive regulation of dendritic cell chemotaxis	IEA
GO:2000510	Process	Positive regulation of dendritic cell chemotaxis	ISS
GO:2000522	Process	Positive regulation of immunological synapse formation	IEA
GO:2000522	Process	Positive regulation of immunological synapse formation	ISS
GO:2000525	Process	Positive regulation of T cell costimulation	IEA
GO:2000525	Process	Positive regulation of T cell costimulation	ISS
GO:2000526	Process	Positive regulation of glycoprotein biosynthetic process involved in immunological synapse formation	IEA
GO:2000526	Process	Positive regulation of glycoprotein biosynthetic process involved in immunological synapse formation	ISS
GO:2000547	Process	Regulation of dendritic cell dendrite assembly	ISS
GO:2000669	Process	Negative regulation of dendritic cell apoptotic process	IC	15059845

Other IDs

• MIM: 600242
• HGNC: 1608
• e!Ensembl: ENSG00000126353

Protein

• UniProt ID: P32248
• Protein name: C-C chemokine receptor type 7 (C-C CKR-7) (CC-CKR-7) (CCR-7) (BLR2) (CDw197) (Epstein-Barr virus-induced G-protein coupled receptor 1) (EBI1) (EBV-induced G-protein coupled receptor 1) (MIP-3 beta receptor) (CD antigen CD197)
• Protein function: Receptor for the MIP-3-beta chemokine. Probable mediator of EBV effects on B-lymphocytes or of normal lymphocyte functions.
• PDB: 6QZH
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	75 → 326	7 transmembrane receptor (rhodopsin family)	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in various lymphoid tissues and activated B- and T-lymphocytes, strongly up-regulated in B-cells infected with Epstein-Barr virus and T-cells infected with herpesvirus 6 or 7.
• Sequence:

  MDLGKPMKSVLVVALLVIFQVCLCQDEVTDDYIGDNTTVDYTLFESLCSKKDVRNFKAWF
  LPIMYSIICFVGLLGNGLVVLTYIYFKRLKTMTDTYLLNLAVADILFLLTLPFWAYSAAK
  SWVFGVHFCKLIFAIYKMSFFSGMLLLLCISIDRYVAIVQAVSAHRHRARVLLISKLSCV
  GIWILATVLSIPELLYSDLQRSSSEQAMRCSLITEHVEAFITIQVAQMVIGFLVPLLAMS
  FCYLVIIRTLLQARNFERNKAIKVIIAVVVVFIVFQLPYNGVVLAQTVANFNITSSTCEL
  SKQLNIAYDVTYSLACVRCCVNPFLYAFIGVKFRNDLFKLFKDLGCLSQEQLRQWSSCRH
  IRRSSMSVEAETTTTFSP

• Sequence length: 378

Pathways

KEGG:

Cytokine-cytokine receptor interaction
Viral protein interaction with cytokine and cytokine receptor
Chemokine signaling pathway

Reactome:

Chemokine receptors bind chemokines
G alpha (i) signalling events

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANHEDONIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC ECZEMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHILDHOOD ONSET ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN DISEASE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHNS DISEASE OF LARGE BOWEL	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKEMIA-LYMPHOMA, ADULT T-CELL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIODONTAL DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIODONTITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RESPIRATORY SYSTEM DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEASONAL ALLERGIC RHINITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STATUS EPILEPTICUS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 1 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
5q-syndrome	5q-syndrome	BEFREE	23054648		★☆☆☆☆ Found in Text Mining only
Acquired Hypogammaglobulinemia	Common Variable Immunodeficiency	BEFREE	15498038		★☆☆☆☆ Found in Text Mining only
Acute leukemia	Leukemia	BEFREE	18192504, 30278283, 8049440, 8932329		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	17101562, 23054648, 27686375, 30787933, 7780155		★☆☆☆☆ Found in Text Mining only
Acute Megakaryocytic Leukemias	Megakaryocytic Leukemia	BEFREE	19016745, 30278283		★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	12393383, 12816872, 18181178, 18272813, 20357826, 22072540, 22488406, 22553314, 23008312, 28538183, 30214063, 8412328, 9266939		★☆☆☆☆ Found in Text Mining only
Acute myeloid leukemia, 11q23 abnormalities	Myeloid Leukemia, 11q23 Abnormalities	BEFREE	31649131		★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	11167805, 12200691, 23770046, 8049440, 9009083		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	18497951		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	23519840, 25168373		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	23922113, 28819407		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	21594558		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	30787933		★☆☆☆☆ Found in Text Mining only
Adult Acute Myeloblastic Leukemia	Myeloblastic Leukemia	BEFREE	20357826, 23251566, 23826213, 26729571		★☆☆☆☆ Found in Text Mining only
Adult Hepatocellular Carcinoma	Liver carcinoma	BEFREE	16786131		★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	16982932		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	CTD_human_DG	26437031		★☆☆☆☆ Found in Text Mining only
Adult type dermatomyositis	Dermatomyositis	BEFREE	29366593		★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	20036791		★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	19208846		★☆☆☆☆ Found in Text Mining only
Anemia Sickle Cell	Sickle cell anemia	Pubtator	24779034, 32267841	Associate	★☆☆☆☆ Found in Text Mining only
Anhedonia	Anhedonia	PSYGENET_DG	24333375		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	28421995, 29434723		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	29439675, 34777635	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	29439675		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	16537455, 21041949, 22163030, 24990231, 28765952		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	29973648		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	33168080, 34691053, 40534874	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Juvenile	Juvenile arthritis	Pubtator	15743472	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	32733468	Stimulate	★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	34681660	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	19804625, 22392503, 36311761	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	35095831	Stimulate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	10627863, 25441632, 27666000		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	19735481, 32914944, 33602227, 34510493, 35000593, 35817495	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	34248969, 38155568	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	16537455, 21041949, 22163030, 24990231, 28765952		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	22619482	Inhibit	★☆☆☆☆ Found in Text Mining only
Autoimmune Chronic Hepatitis	Autoimmune hepatitis	BEFREE	31020718		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	15147571, 16887149, 17587445, 28389388, 28811651		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	15147571, 17587445, 26684629, 36656709	Associate	★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	30087107		★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	15155773		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	15196263, 23336215, 31614573	Associate	★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	22884357, 31614573		★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	BEFREE	20462630		★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	25256673, 25682287		★☆☆☆☆ Found in Text Mining only
Blast Phase	Blast phase chronic myelogenous leukemia	BEFREE	11835339, 15322764, 18613965, 20855863, 7780155, 7808006, 8412328, 8611478, 9183665, 9432037		★☆☆☆☆ Found in Text Mining only
Brain Injuries Traumatic	Brain injuries	Pubtator	28222567	Inhibit	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	12935890, 17178876, 17351259, 19196101, 21149644, 24935473, 25142946, 25327843, 25744065, 25772241, 28137279, 28209621, 28378417, 28416768, 28930757, 28994018, 30032244, 30592274, 31072446		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	17351259, 18319253, 19049961, 19305150, 20181250, 21288332, 21624121, 23667660, 25744065, 28059167, 28930757, 37864213, 37950222	Associate	★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	21672222	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	31011147	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	26517519, 26813566, 29436633, 30633620, 33189609, 38552222	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	28534984		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	26884842		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	25168373	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	20976171	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	26219899	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	22699780, 32775427	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	17032700	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	18505078, 27666723	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	20462630, 23517670, 25168373, 25636509, 8932329		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	16584112, 36233294	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	Pubtator	36187128	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	40696650	Associate	★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	30787933		★☆☆☆☆ Found in Text Mining only
Childhood Acute Myeloid Leukemia	Acute Myeloid Leukemia	BEFREE	17243162, 20357826, 25567132		★☆☆☆☆ Found in Text Mining only
Childhood Hepatocellular Carcinoma	Liver carcinoma	BEFREE	16786131		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	33045415	Associate	★☆☆☆☆ Found in Text Mining only
Cholangitis Sclerosing	Sclerosing cholangitis	Pubtator	11943728, 30785638	Associate	★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	BEFREE	31813289		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	28811651, 30303980		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	LHGDN	11929789, 17890452		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	15008605, 15155773, 16225771, 19074885, 25724841, 25936528, 26282174, 29326436		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	20420706		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	24347371	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	21276449, 22161860, 23665236		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	18437055		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	31815761		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	18623114, 22161860, 24705643, 31815051		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	16371631, 16641550, 22276195, 26179425, 35395711	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	16641550		★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common Variable Immunodeficiency	BEFREE	15498038, 19747210, 27069935		★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common variable immunodeficiency	Pubtator	15498038, 15598813	Associate	★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common variable immunodeficiency	Pubtator	19747210	Inhibit	★☆☆☆☆ Found in Text Mining only
Complex Partial Status Epilepticus	Status Epilepticus	CTD_human_DG	17181556		★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	10484986, 11167805, 15085164, 20308656, 29288910, 8412328, 8611478		★☆☆☆☆ Found in Text Mining only
Congenital thrombocytopenia	Congenital thrombocytopenia	BEFREE	22972950		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	22427939		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	24990231		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	17170367, 24990231, 27317472		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	24699314	Associate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	24990231		★☆☆☆☆ Found in Text Mining only
CRANIOOSTEOARTHROPATHY	Cranioosteoarthropathy	BEFREE	25441632		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	16118351, 20150960, 23168838	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn Disease	Crohn Disease	BEFREE	16189151, 25637591		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn Disease	Crohn disease	Pubtator	16189151	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn Disease	Crohn disease	Pubtator	19095953	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Degenerative polyarthritis	Arthritis	BEFREE	28767178		★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	26288354, 32035984	Associate	★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	BEFREE	29366593		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	28454543, 36187128	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	30184318	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	16045741, 25421756	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	18803760	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	36187128, 36557031	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes, Autoimmune	Autoimmune Diabetes	BEFREE	28811651		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	30904045		★☆☆☆☆ Found in Text Mining only
Diffuse Scleroderma	Scleroderma	BEFREE	31789272		★☆☆☆☆ Found in Text Mining only
Disorder of eye	Disorder Of Eye	BEFREE	31702421		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	25222269	Associate	★☆☆☆☆ Found in Text Mining only
Dry Eye Syndromes	Dry Eye Syndromes	BEFREE	31702421		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	2115646, 8932329		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	28856757		★☆☆☆☆ Found in Text Mining only
Ependymoma	Ependymoma	BEFREE	21493867		★☆☆☆☆ Found in Text Mining only
Epidermodysplasia Verruciformis	Epidermodysplasia Verruciformis	BEFREE	30473695		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	26667143	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	26667143	Associate	★☆☆☆☆ Found in Text Mining only
Exanthema	Exanthema	Pubtator	20646339	Associate	★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi Anemia	BEFREE	17243162		★☆☆☆☆ Found in Text Mining only
FANCONI ANEMIA, COMPLEMENTATION GROUP A (disorder)	Anemia	BEFREE	17243162		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	28811651		★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	27009073		★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	23519840		★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	Pubtator	15654831	Associate	★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	Pubtator	22936065	Stimulate	★☆☆☆☆ Found in Text Mining only
GATA2 Deficiency	GATA2 Deficiency	BEFREE	28630119		★☆☆☆☆ Found in Text Mining only
Generalized enlarged lymph nodes	Enlarged Lymph Nodes	BEFREE	16018941		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	30009488, 35996545	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	30009488		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	21493867		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	28620836, 31649684	Associate	★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	24621606	Inhibit	★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	20185583, 23179902, 28965881		★☆☆☆☆ Found in Text Mining only
Grand Mal Status Epilepticus	Grand Mal Status Epilepticus	CTD_human_DG	17181556		★☆☆☆☆ Found in Text Mining only
Granulomatosis with Polyangiitis	Granulomatosis with polyangiitis	Pubtator	16837919, 22490506	Associate	★☆☆☆☆ Found in Text Mining only
Granulomatous Disease Chronic	Granulomatous disease	Pubtator	12414528	Associate	★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves disease	Pubtator	35720300	Associate	★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	29706190		★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	22427939		★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	36420258	Associate	★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	14551738, 16342172, 17011981, 19385966, 22634393, 26674644, 28779353, 8049440, 9031072		★☆☆☆☆ Found in Text Mining only
Hematopoietic Neoplasms	Hematopoietic Neoplasms	BEFREE	28779353		★☆☆☆☆ Found in Text Mining only
Hepatitis C Chronic	Hepatitis c	Pubtator	15057302	Associate	★☆☆☆☆ Found in Text Mining only
Histiocytosis, Langerhans-Cell	Histiocytosis	LHGDN	12642342		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	11830455, 16982932		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	11830455, 16982932, 18488221	Associate	★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	BEFREE	25825525		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	21498626		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	19305150, 25168373, 30459756	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	20029460	Inhibit	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	28416768	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	21498626, 29687634, 30229666		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	16394278	Stimulate	★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	17331965		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	17331965	Associate	★☆☆☆☆ Found in Text Mining only
Ileitis	Ileitis	BEFREE	25637591		★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	17392156		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	21903765	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Breast Carcinoma	Breast Cancer	BEFREE	17351259		★☆☆☆☆ Found in Text Mining only
Intestinal Cancer	Intestinal Cancer	BEFREE	15867478		★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial aneurysm	Pubtator	38538213	Associate	★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	30349952		★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	BEFREE	15743472		★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	LHGDN	15743472		★☆☆☆☆ Found in Text Mining only
Juvenile Myelomonocytic Leukemia	Myelomonocytic Leukemia	BEFREE	9432037, 9447818		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	28811651		★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	23835793		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	10557037, 10867128, 11908737, 11922610, 1434816, 15156182, 1552747, 1593910, 16109773, 16342172, 17483069, 17507183, 17635584, 18206536, 19016745, 19385966, 20084277, 21289308, 21795762, 22553314, 22689058, 23235717, 23826213, 24703711, 24703906, 24735919, 25567132, 26674644, 26931577, 28391050, 29939287, 30608452, 31649131, 7780155, 7808006, 8643684, 8656673, 8813093, 9009083, 9031072, 9067573, 9183665, 9192861, 9432037, 9619838		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	17597825	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	27258612	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	11050005, 11167805, 11721451, 12139729, 12393383, 12816872, 14585371, 14607750, 15138998, 1552747, 1570317, 16843110, 17243162, 17525718, 17693189, 17693194, 18181178, 18192504, 18272813, 19665075, 19965692, 20308656, 20357826, 20556821, 20842122, 21289308, 21596848, 21750091, 22072540, 22488406, 22553314, 22682625, 22689058, 22847614, 22887804, 23008312, 23826213, 24495476, 25331116, 26467814, 26496831, 26729571, 27140599, 28191887, 28362701, 28391050, 28538183, 30214063, 31072628, 31482295, 31593983, 31822659, 7780155, 7919381, 8049440, 8118036, 8412328, 8613429, 8813093, 9009083, 9067573, 9192861, 9266939, 9432037, 9861236		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelomonocytic, Chronic	Myelomonocytic Leukemia	BEFREE	8049440		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	16786131, 17075975, 25225162, 25255875, 25959919, 26967394, 30107147, 30633620		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	16786131		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	22727562	Inhibit	★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	16786131		★☆☆☆☆ Found in Text Mining only
Localized scleroderma	Scleroderma	BEFREE	21616095		★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	16394278	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	12673677		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	19305150, 19309748, 23649655, 26884842, 28487957	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Cutaneous	Cutaneous lupus erythematosus	Pubtator	35258358	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	15147571, 16802356, 17587445, 26395317, 34220794, 36351407	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	20478074, 24829414	Stimulate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	15147571, 16802356, 17587445, 28396669, 29684636		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	LHGDN	16802356		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	15040017, 23519840, 26179425, 28930757	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	15654831, 17032700, 18319253, 18505078, 19305150, 20181250, 22976543, 23649655, 24040244, 25168373, 25405202, 25744065, 26176983, 26667143, 26884842, 27666723, 27814720, 28114889, 28487957, 28841151, 29575464, 33158173	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	16786131, 24915301, 26667143, 29575464, 30690891		★☆☆☆☆ Found in Text Mining only
Lymphohistiocytosis Hemophagocytic	Hemophagocytic lymphohistiocytosis	Pubtator	12642342	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	11756152, 18842429, 26121143	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	26121143, 31526758		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	LHGDN	16690519		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	21548969		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	21548969		★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	BEFREE	15727636		★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative syndrome	Pubtator	17302894, 18842429	Associate	★☆☆☆☆ Found in Text Mining only
Malformations of Cortical Development, Group II	Malformation of cortical development	BEFREE	29669284		★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	29706190		★☆☆☆☆ Found in Text Mining only
Malignant lymphoma, lymphocytic, intermediate differentiation, diffuse	Malignant lymphoma, lymphocytic, intermediate differentiation	BEFREE	24305507		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	12935890, 17178876, 17351259, 19196101, 21149644, 24935473, 25327843, 25744065, 25772241, 28137279, 28209621, 28378417, 28416768, 28930757, 28994018, 30032244, 30592274, 31072446		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	27009073		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	16786131		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	26884842		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	16951150, 17409414, 20462630, 8932329		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	18544997, 21594558, 27505247		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	16018941, 25256673, 25682287, 26722441, 28903065, 29575464		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	19513547, 23519840, 24040244, 25572817, 26984468		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	31146261		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	28534984		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	12551823, 15155773, 15867478, 16342172, 16641550, 17341266, 17409414, 18181178, 18544997, 18815193, 19231068, 19363519, 21057539, 21149644, 22308434, 22972950, 23054648, 24495476, 25142946, 25491945, 25572817, 25886616, 26496831, 27248053, 27991928, 28209621, 28817313, 28841151, 28903065, 29706190, 29879503, 29939287, 30592274, 30770775, 30940644, 30977974, 31137829, 8049440, 8946927		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	21276449, 22161860, 23665236		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	16115904, 17178876, 18319253		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	17178876, 25557171		★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	24305507, 29979193		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	15073111, 15753377, 18235009		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	15345595, 20736366, 22433180, 30728070	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	15753377, 30940644		★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	31983065	Associate	★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	30940644		★☆☆☆☆ Found in Text Mining only
Miller Dieker syndrome	Miller Dieker Syndrome	BEFREE	11721451, 9009083		★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	BEFREE	31504210		★☆☆☆☆ Found in Text Mining only
Monoclonal Gammopathy of Undetermined Significance	Monoclonal Gammapathies	BEFREE	16410445		★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	33188570	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	12406901, 16410445, 16542368, 20658475	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	15155773, 20658475, 31164886		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	31164886	Inhibit	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	LHGDN	15122702		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	17110420, 18573819, 25957582, 28389388		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	20621365, 24856897, 26829210, 27752051	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	21622858	Inhibit	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	31857644	Stimulate	★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia Gravis	BEFREE	26616645		★☆☆☆☆ Found in Text Mining only
Mycosis Fungoides	Mycosis fungoides	Pubtator	14708605	Associate	★☆☆☆☆ Found in Text Mining only
Myelodysplasia	Myelodysplasia	BEFREE	20556821, 24495476, 7780155, 8695798, 8932329, 9009083, 9031072		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	10641791, 11050005, 11721451, 15156182, 15203277, 18192504, 18655152, 19016745, 19208846, 19605700, 19665075, 20222800, 20556821, 22488406, 23471304, 23517670, 29288910, 7780155, 7845018, 8049440, 8695798, 8932329, 9009083, 9031072, 9067573, 9432037		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndrome with Isolated del(5q)	Myelodysplastic syndrome	BEFREE	23054648		★☆☆☆☆ Found in Text Mining only
Myelodysplastic-Myeloproliferative Diseases	Myelodysplastic-Myeloproliferative Diseases	BEFREE	29288910		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	BEFREE	10557037, 10641791, 11587364, 12461752, 12816872, 12972028, 14551738, 1570317, 18815193, 20084277, 28209621, 9447815, 9498702		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	11835339, 15156182, 15322764, 15674360, 17341266, 18613965, 19016745, 22634393, 27967290, 29288910, 7780155, 7808006, 8412328, 8656667, 8656673, 9432037		★☆☆☆☆ Found in Text Mining only
Myelomonocytic leukemia	Myelomonocytic Leukemia	BEFREE	22847614		★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	BEFREE	28338652, 29288910, 9447818		★☆☆☆☆ Found in Text Mining only
Myocardial Failure	Myocardial Infarction	BEFREE	22427939		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	27317472		★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	LHGDN	15950936		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	16000558, 30770775, 31758524		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10641791, 11587364, 12019175, 12791091, 15138998, 15654831, 15867478, 16018941, 16786131, 16951150, 17894555, 18696160, 19536265, 19731977, 20084277, 21548969, 22553314, 22644515, 23054648, 23285037, 23350854, 23519840, 23835793, 24040244, 24052640, 24305507, 24495476, 24703906, 25142946, 25168373, 25557171, 25772241, 25886616, 25959919, 26722441, 26984468, 27628325, 28114889, 28416768, 28534984, 28840842, 28904226, 30278283, 30283982, 30462309, 30871130, 31072446, 31423253, 31463641, 8656667		★☆☆☆☆ Found in Text Mining only
Non-Convulsive Status Epilepticus	Nonconvulsive status epilepticus	CTD_human_DG	17181556		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	12673677, 14581340, 17487412, 22438908, 26884842, 28339080, 31463641		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	28454543, 28903065	Associate	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	31312229		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	39304950	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	BEFREE	28767178		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	35422889	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	8932329		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	20462630, 8932329		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	18544997, 21594558, 27505247		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	18544997		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	27505247, 29687228	Associate	★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	18696160, 19731977, 27574129		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	28965931		★☆☆☆☆ Found in Text Mining only
Petit mal status	Petit Mal Status	CTD_human_DG	17181556		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	39608739	Associate	★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia Vera	BEFREE	20601445		★☆☆☆☆ Found in Text Mining only
Polymyositis	Polymyositis	Pubtator	14730617	Associate	★☆☆☆☆ Found in Text Mining only
Polymyositis	Polymyositis	BEFREE	16887149		★☆☆☆☆ Found in Text Mining only
Polymyositis	Polymyositis	LHGDN	16887149		★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	16863916, 17709502, 23054648		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	27686375, 7780155, 9861236		★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	19536265, 26931577, 27686375		★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	14517790		★☆☆☆☆ Found in Text Mining only
Primary central nervous system lymphoma	Central Nervous System Lymphoma	BEFREE	31526758		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	16018941, 25256673, 25682287, 26722441, 28903065, 29575464		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	25256673, 25682287, 28903065, 29575464, 38087324	Associate	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	19068542, 23731727		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	23731727, 40534874	Associate	★☆☆☆☆ Found in Text Mining only
Psoriasis vulgaris	Psoriasis vulgaris	BEFREE	19068542		★☆☆☆☆ Found in Text Mining only
Pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	21498626		★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	25338516	Inhibit	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	34704847, 36655999	Associate	★☆☆☆☆ Found in Text Mining only
Radioulnar Synostosis	Radioulnar Synostosis	BEFREE	29540340		★☆☆☆☆ Found in Text Mining only
Radioulnar Synostosis with Amegakaryocytic Thrombocytopenia	Radioulnar Synostosis With Amegakaryocytic Thrombocytopenia	BEFREE	26581901		★☆☆☆☆ Found in Text Mining only
Refractory anaemia with excess blasts	Myelodysplastic syndrome	BEFREE	7845018, 8049440		★☆☆☆☆ Found in Text Mining only
Refractory anemias	Anemia	BEFREE	8049440		★☆☆☆☆ Found in Text Mining only
Respiratory Tract Diseases	Respiratory system infectious disease	Pubtator	16394278	Associate	★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	28730075		★☆☆☆☆ Found in Text Mining only
Retinopathy of Prematurity	Retinopathy	BEFREE	28730075		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	28389388, 28729639, 29973648, 31137829, 31342120		★☆☆☆☆ Found in Text Mining only
Salivary Gland Neoplasms	Salivary gland neoplasm	BEFREE	31115008		★☆☆☆☆ Found in Text Mining only
Salivary Gland Neoplasms	Salivary gland neoplasms	Pubtator	31115008	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	BEFREE	12626344		★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	17587445, 32977850, 40534874	Associate	★☆☆☆☆ Found in Text Mining only
secondary acute myeloid leukemia	Myeloid leukemia	BEFREE	20357826		★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	34484417	Associate	★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary Syndrome	BEFREE	15727636		★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary syndrome	Pubtator	17597825	Associate	★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	17587445, 31068931	Associate	★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	35258358	Associate	★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	20484084		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	16223574, 16278415		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	22976543		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	22644515, 24766770, 26667143, 31773415		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	21071608, 22158872, 22976543, 25405202, 27666723, 29063902, 31011147, 32228580, 37988195	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	20036791, 21071608, 21735098, 25405202, 26352169, 28521425, 31205553		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	27666723, 31011147, 31555130		★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	CTD_human_DG	17181556		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Status Epilepticus, Subclinical	Status Epilepticus	CTD_human_DG	17181556		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	28811651		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	12019175, 15654831, 19513547, 23519840, 24040244, 25572817, 26984468		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	15040017, 15654831, 15867478, 23519840, 24040244, 26176983, 36735714, 37208608	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	15867478		★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	BEFREE	25724256		★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	Pubtator	25724256	Associate	★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	17587445, 23994768, 31789272		★☆☆☆☆ Found in Text Mining only
Thrombocytosis	Thrombocytosis	BEFREE	30278283		★☆☆☆☆ Found in Text Mining only
Thymoma	Thymoma	BEFREE	20081105		★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	17065406, 31146261		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	LHGDN	18696160		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	31146261		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	28930757, 30032244, 31423253		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	28930757, 37963845	Associate	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	16189151		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	25798926, 27814720, 28534984	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	17032700, 35062905	Associate	★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal Melanoma	BEFREE	18235009, 24052640		★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	23164171, 35341390	Associate	★☆☆☆☆ Found in Text Mining only
Uveitis	Uveitis	Pubtator	15196263	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	29246895		★☆☆☆☆ Found in Text Mining only
Venous Thrombosis	Venous thrombosis	Pubtator	37443254	Associate	★☆☆☆☆ Found in Text Mining only