Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	1234
Gene name	C-C motif chemokine receptor 5
Gene symbol	CCR5
Synonyms (NCBI Gene)	CC-CKR-5CCCKR5CCR-5CD195CKR-5CKR5CMKBR5IDDM22
Chromosome	3
Chromosome location	3p21.31
Summary	This gene encodes a member of the beta chemokine receptor family, which is predicted to be a seven transmembrane protein similar to G protein-coupled receptors. This protein is expressed by T cells and macrophages, and is known to be an important co-recep

287

Show/Hide all (287)

miRTarBase ID	miRNA	Experiments	Reference
MIRT620771	hsa-miR-5193	HITS-CLIP	23824327
MIRT620769	hsa-miR-1237-3p	HITS-CLIP	23824327
MIRT620768	hsa-miR-1248	HITS-CLIP	23824327
MIRT620767	hsa-miR-6889-3p	HITS-CLIP	23824327
MIRT620766	hsa-miR-5008-3p	HITS-CLIP	23824327
MIRT620765	hsa-miR-6737-3p	HITS-CLIP	23824327
MIRT620764	hsa-miR-7157-3p	HITS-CLIP	23824327
MIRT620763	hsa-miR-3182	HITS-CLIP	23824327
MIRT620762	hsa-miR-6868-3p	HITS-CLIP	23824327
MIRT620771	hsa-miR-5193	HITS-CLIP	23824327
MIRT620769	hsa-miR-1237-3p	HITS-CLIP	23824327
MIRT620768	hsa-miR-1248	HITS-CLIP	23824327
MIRT620767	hsa-miR-6889-3p	HITS-CLIP	23824327
MIRT620766	hsa-miR-5008-3p	HITS-CLIP	23824327
MIRT620765	hsa-miR-6737-3p	HITS-CLIP	23824327
MIRT620764	hsa-miR-7157-3p	HITS-CLIP	23824327
MIRT620763	hsa-miR-3182	HITS-CLIP	23824327
MIRT620762	hsa-miR-6868-3p	HITS-CLIP	23824327
MIRT620761	hsa-miR-548ac	HITS-CLIP	23824327
MIRT620760	hsa-miR-548bb-3p	HITS-CLIP	23824327
MIRT620759	hsa-miR-548d-3p	HITS-CLIP	23824327
MIRT620758	hsa-miR-548h-3p	HITS-CLIP	23824327
MIRT620757	hsa-miR-548z	HITS-CLIP	23824327
MIRT620756	hsa-miR-6800-3p	HITS-CLIP	23824327
MIRT620755	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT620754	hsa-miR-3183	HITS-CLIP	23824327
MIRT620753	hsa-miR-4723-3p	HITS-CLIP	23824327
MIRT620752	hsa-miR-6769b-3p	HITS-CLIP	23824327
MIRT620751	hsa-miR-4469	HITS-CLIP	23824327
MIRT620750	hsa-miR-7113-3p	HITS-CLIP	23824327
MIRT620749	hsa-miR-4287	HITS-CLIP	23824327
MIRT620748	hsa-miR-4685-3p	HITS-CLIP	23824327
MIRT620747	hsa-miR-6845-3p	HITS-CLIP	23824327
MIRT620746	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT620745	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT620744	hsa-miR-203a-3p	HITS-CLIP	23824327
MIRT641338	hsa-miR-204-5p	HITS-CLIP	23824327
MIRT641337	hsa-miR-211-5p	HITS-CLIP	23824327
MIRT620743	hsa-miR-6867-3p	HITS-CLIP	23824327
MIRT620742	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT620741	hsa-miR-510-3p	HITS-CLIP	23824327
MIRT620761	hsa-miR-548ac	HITS-CLIP	23824327
MIRT620760	hsa-miR-548bb-3p	HITS-CLIP	23824327
MIRT620759	hsa-miR-548d-3p	HITS-CLIP	23824327
MIRT620758	hsa-miR-548h-3p	HITS-CLIP	23824327
MIRT620757	hsa-miR-548z	HITS-CLIP	23824327
MIRT620756	hsa-miR-6800-3p	HITS-CLIP	23824327
MIRT620755	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT620754	hsa-miR-3183	HITS-CLIP	23824327
MIRT620753	hsa-miR-4723-3p	HITS-CLIP	23824327
MIRT620752	hsa-miR-6769b-3p	HITS-CLIP	23824327
MIRT620751	hsa-miR-4469	HITS-CLIP	23824327
MIRT620750	hsa-miR-7113-3p	HITS-CLIP	23824327
MIRT620749	hsa-miR-4287	HITS-CLIP	23824327
MIRT620748	hsa-miR-4685-3p	HITS-CLIP	23824327
MIRT620747	hsa-miR-6845-3p	HITS-CLIP	23824327
MIRT620746	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT620745	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT620744	hsa-miR-203a-3p	HITS-CLIP	23824327
MIRT641338	hsa-miR-204-5p	HITS-CLIP	23824327
MIRT641337	hsa-miR-211-5p	HITS-CLIP	23824327
MIRT620743	hsa-miR-6867-3p	HITS-CLIP	23824327
MIRT620742	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT620741	hsa-miR-510-3p	HITS-CLIP	23824327
MIRT620771	hsa-miR-5193	HITS-CLIP	23824327
MIRT620770	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT620769	hsa-miR-1237-3p	HITS-CLIP	23824327
MIRT620768	hsa-miR-1248	HITS-CLIP	23824327
MIRT620767	hsa-miR-6889-3p	HITS-CLIP	23824327
MIRT620766	hsa-miR-5008-3p	HITS-CLIP	23824327
MIRT620765	hsa-miR-6737-3p	HITS-CLIP	23824327
MIRT620764	hsa-miR-7157-3p	HITS-CLIP	23824327
MIRT620763	hsa-miR-3182	HITS-CLIP	23824327
MIRT620762	hsa-miR-6868-3p	HITS-CLIP	23824327
MIRT620761	hsa-miR-548ac	HITS-CLIP	23824327
MIRT620760	hsa-miR-548bb-3p	HITS-CLIP	23824327
MIRT620759	hsa-miR-548d-3p	HITS-CLIP	23824327
MIRT620758	hsa-miR-548h-3p	HITS-CLIP	23824327
MIRT620757	hsa-miR-548z	HITS-CLIP	23824327
MIRT620756	hsa-miR-6800-3p	HITS-CLIP	23824327
MIRT620755	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT620754	hsa-miR-3183	HITS-CLIP	23824327
MIRT620753	hsa-miR-4723-3p	HITS-CLIP	23824327
MIRT620752	hsa-miR-6769b-3p	HITS-CLIP	23824327
MIRT620751	hsa-miR-4469	HITS-CLIP	23824327
MIRT620750	hsa-miR-7113-3p	HITS-CLIP	23824327
MIRT620749	hsa-miR-4287	HITS-CLIP	23824327
MIRT620748	hsa-miR-4685-3p	HITS-CLIP	23824327
MIRT620747	hsa-miR-6845-3p	HITS-CLIP	23824327
MIRT620746	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT620745	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT620744	hsa-miR-203a-3p	HITS-CLIP	23824327
MIRT620743	hsa-miR-6867-3p	HITS-CLIP	23824327
MIRT620742	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT620741	hsa-miR-510-3p	HITS-CLIP	23824327
MIRT620771	hsa-miR-5193	HITS-CLIP	23824327
MIRT620769	hsa-miR-1237-3p	HITS-CLIP	23824327
MIRT620768	hsa-miR-1248	HITS-CLIP	23824327
MIRT620767	hsa-miR-6889-3p	HITS-CLIP	23824327
MIRT620766	hsa-miR-5008-3p	HITS-CLIP	23824327
MIRT620765	hsa-miR-6737-3p	HITS-CLIP	23824327
MIRT620764	hsa-miR-7157-3p	HITS-CLIP	23824327
MIRT620763	hsa-miR-3182	HITS-CLIP	23824327
MIRT620762	hsa-miR-6868-3p	HITS-CLIP	23824327
MIRT620771	hsa-miR-5193	HITS-CLIP	23824327
MIRT620769	hsa-miR-1237-3p	HITS-CLIP	23824327
MIRT620768	hsa-miR-1248	HITS-CLIP	23824327
MIRT620767	hsa-miR-6889-3p	HITS-CLIP	23824327
MIRT620766	hsa-miR-5008-3p	HITS-CLIP	23824327
MIRT620765	hsa-miR-6737-3p	HITS-CLIP	23824327
MIRT620764	hsa-miR-7157-3p	HITS-CLIP	23824327
MIRT620763	hsa-miR-3182	HITS-CLIP	23824327
MIRT620762	hsa-miR-6868-3p	HITS-CLIP	23824327
MIRT620761	hsa-miR-548ac	HITS-CLIP	23824327
MIRT620760	hsa-miR-548bb-3p	HITS-CLIP	23824327
MIRT620759	hsa-miR-548d-3p	HITS-CLIP	23824327
MIRT620758	hsa-miR-548h-3p	HITS-CLIP	23824327
MIRT620757	hsa-miR-548z	HITS-CLIP	23824327
MIRT620756	hsa-miR-6800-3p	HITS-CLIP	23824327
MIRT620755	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT620754	hsa-miR-3183	HITS-CLIP	23824327
MIRT620753	hsa-miR-4723-3p	HITS-CLIP	23824327
MIRT620752	hsa-miR-6769b-3p	HITS-CLIP	23824327
MIRT620751	hsa-miR-4469	HITS-CLIP	23824327
MIRT620750	hsa-miR-7113-3p	HITS-CLIP	23824327
MIRT620749	hsa-miR-4287	HITS-CLIP	23824327
MIRT620748	hsa-miR-4685-3p	HITS-CLIP	23824327
MIRT620747	hsa-miR-6845-3p	HITS-CLIP	23824327
MIRT620746	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT620745	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT620744	hsa-miR-203a-3p	HITS-CLIP	23824327
MIRT641338	hsa-miR-204-5p	HITS-CLIP	23824327
MIRT641337	hsa-miR-211-5p	HITS-CLIP	23824327
MIRT620743	hsa-miR-6867-3p	HITS-CLIP	23824327
MIRT620742	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT620741	hsa-miR-510-3p	HITS-CLIP	23824327
MIRT620761	hsa-miR-548ac	HITS-CLIP	23824327
MIRT620760	hsa-miR-548bb-3p	HITS-CLIP	23824327
MIRT620759	hsa-miR-548d-3p	HITS-CLIP	23824327
MIRT620758	hsa-miR-548h-3p	HITS-CLIP	23824327
MIRT620757	hsa-miR-548z	HITS-CLIP	23824327
MIRT620756	hsa-miR-6800-3p	HITS-CLIP	23824327
MIRT620755	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT620754	hsa-miR-3183	HITS-CLIP	23824327
MIRT620753	hsa-miR-4723-3p	HITS-CLIP	23824327
MIRT620752	hsa-miR-6769b-3p	HITS-CLIP	23824327
MIRT620751	hsa-miR-4469	HITS-CLIP	23824327
MIRT620750	hsa-miR-7113-3p	HITS-CLIP	23824327
MIRT620749	hsa-miR-4287	HITS-CLIP	23824327
MIRT620748	hsa-miR-4685-3p	HITS-CLIP	23824327
MIRT620747	hsa-miR-6845-3p	HITS-CLIP	23824327
MIRT620746	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT620745	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT620744	hsa-miR-203a-3p	HITS-CLIP	23824327
MIRT641338	hsa-miR-204-5p	HITS-CLIP	23824327
MIRT641337	hsa-miR-211-5p	HITS-CLIP	23824327
MIRT620743	hsa-miR-6867-3p	HITS-CLIP	23824327
MIRT620742	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT620741	hsa-miR-510-3p	HITS-CLIP	23824327
MIRT620771	hsa-miR-5193	HITS-CLIP	23824327
MIRT620770	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT620769	hsa-miR-1237-3p	HITS-CLIP	23824327
MIRT620768	hsa-miR-1248	HITS-CLIP	23824327
MIRT620767	hsa-miR-6889-3p	HITS-CLIP	23824327
MIRT620766	hsa-miR-5008-3p	HITS-CLIP	23824327
MIRT620765	hsa-miR-6737-3p	HITS-CLIP	23824327
MIRT620764	hsa-miR-7157-3p	HITS-CLIP	23824327
MIRT620763	hsa-miR-3182	HITS-CLIP	23824327
MIRT620762	hsa-miR-6868-3p	HITS-CLIP	23824327
MIRT620761	hsa-miR-548ac	HITS-CLIP	23824327
MIRT620760	hsa-miR-548bb-3p	HITS-CLIP	23824327
MIRT620759	hsa-miR-548d-3p	HITS-CLIP	23824327
MIRT620758	hsa-miR-548h-3p	HITS-CLIP	23824327
MIRT620757	hsa-miR-548z	HITS-CLIP	23824327
MIRT620756	hsa-miR-6800-3p	HITS-CLIP	23824327
MIRT620755	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT620754	hsa-miR-3183	HITS-CLIP	23824327
MIRT620753	hsa-miR-4723-3p	HITS-CLIP	23824327
MIRT620752	hsa-miR-6769b-3p	HITS-CLIP	23824327
MIRT620751	hsa-miR-4469	HITS-CLIP	23824327
MIRT620750	hsa-miR-7113-3p	HITS-CLIP	23824327
MIRT620749	hsa-miR-4287	HITS-CLIP	23824327
MIRT620748	hsa-miR-4685-3p	HITS-CLIP	23824327
MIRT620747	hsa-miR-6845-3p	HITS-CLIP	23824327
MIRT620746	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT620745	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT620744	hsa-miR-203a-3p	HITS-CLIP	23824327
MIRT620743	hsa-miR-6867-3p	HITS-CLIP	23824327
MIRT620742	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT620741	hsa-miR-510-3p	HITS-CLIP	23824327
MIRT873222	hsa-miR-2115	CLIP-seq
MIRT873223	hsa-miR-2277-3p	CLIP-seq
MIRT873224	hsa-miR-3074-5p	CLIP-seq
MIRT873225	hsa-miR-345	CLIP-seq
MIRT873226	hsa-miR-3660	CLIP-seq
MIRT873227	hsa-miR-370	CLIP-seq
MIRT873228	hsa-miR-3977	CLIP-seq
MIRT873229	hsa-miR-451b	CLIP-seq
MIRT873230	hsa-miR-4526	CLIP-seq
MIRT873231	hsa-miR-4691-3p	CLIP-seq
MIRT873232	hsa-miR-4696	CLIP-seq
MIRT873233	hsa-miR-4714-5p	CLIP-seq
MIRT873234	hsa-miR-516a-3p	CLIP-seq
MIRT873235	hsa-miR-628-5p	CLIP-seq
MIRT873236	hsa-miR-1279	CLIP-seq
MIRT873237	hsa-miR-2113	CLIP-seq
MIRT873222	hsa-miR-2115	CLIP-seq
MIRT873223	hsa-miR-2277-3p	CLIP-seq
MIRT873224	hsa-miR-3074-5p	CLIP-seq
MIRT873226	hsa-miR-3660	CLIP-seq
MIRT873227	hsa-miR-370	CLIP-seq
MIRT873238	hsa-miR-3929	CLIP-seq
MIRT873228	hsa-miR-3977	CLIP-seq
MIRT873239	hsa-miR-4251	CLIP-seq
MIRT873240	hsa-miR-4257	CLIP-seq
MIRT873241	hsa-miR-4265	CLIP-seq
MIRT873242	hsa-miR-4296	CLIP-seq
MIRT873243	hsa-miR-4322	CLIP-seq
MIRT873244	hsa-miR-4419b	CLIP-seq
MIRT873245	hsa-miR-4478	CLIP-seq
MIRT873246	hsa-miR-4490	CLIP-seq
MIRT873230	hsa-miR-4526	CLIP-seq
MIRT873231	hsa-miR-4691-3p	CLIP-seq
MIRT873247	hsa-miR-485-5p	CLIP-seq
MIRT873234	hsa-miR-516a-3p	CLIP-seq
MIRT873248	hsa-miR-539	CLIP-seq
MIRT873235	hsa-miR-628-5p	CLIP-seq
MIRT873249	hsa-miR-629	CLIP-seq
MIRT1959090	hsa-miR-1321	CLIP-seq
MIRT1959091	hsa-miR-185	CLIP-seq
MIRT873222	hsa-miR-2115	CLIP-seq
MIRT873223	hsa-miR-2277-3p	CLIP-seq
MIRT873224	hsa-miR-3074-5p	CLIP-seq
MIRT873226	hsa-miR-3660	CLIP-seq
MIRT873227	hsa-miR-370	CLIP-seq
MIRT873228	hsa-miR-3977	CLIP-seq
MIRT1959092	hsa-miR-4306	CLIP-seq
MIRT1959093	hsa-miR-4419a	CLIP-seq
MIRT1959094	hsa-miR-4510	CLIP-seq
MIRT873230	hsa-miR-4526	CLIP-seq
MIRT1959095	hsa-miR-4644	CLIP-seq
MIRT873231	hsa-miR-4691-3p	CLIP-seq
MIRT1959096	hsa-miR-4728-5p	CLIP-seq
MIRT1959097	hsa-miR-4739	CLIP-seq
MIRT1959098	hsa-miR-4756-5p	CLIP-seq
MIRT1959099	hsa-miR-511	CLIP-seq
MIRT873234	hsa-miR-516a-3p	CLIP-seq
MIRT1959100	hsa-miR-579	CLIP-seq
MIRT1959101	hsa-miR-607	CLIP-seq
MIRT873235	hsa-miR-628-5p	CLIP-seq
MIRT1959102	hsa-miR-664	CLIP-seq
MIRT2196029	hsa-miR-150	CLIP-seq
MIRT873222	hsa-miR-2115	CLIP-seq
MIRT873223	hsa-miR-2277-3p	CLIP-seq
MIRT873224	hsa-miR-3074-5p	CLIP-seq
MIRT873225	hsa-miR-345	CLIP-seq
MIRT873226	hsa-miR-3660	CLIP-seq
MIRT873227	hsa-miR-370	CLIP-seq
MIRT2196030	hsa-miR-376a	CLIP-seq
MIRT2196031	hsa-miR-376b	CLIP-seq
MIRT873238	hsa-miR-3929	CLIP-seq
MIRT873228	hsa-miR-3977	CLIP-seq
MIRT873239	hsa-miR-4251	CLIP-seq
MIRT2196032	hsa-miR-4277	CLIP-seq
MIRT873244	hsa-miR-4419b	CLIP-seq
MIRT873245	hsa-miR-4478	CLIP-seq
MIRT2196033	hsa-miR-4522	CLIP-seq
MIRT873230	hsa-miR-4526	CLIP-seq
MIRT873231	hsa-miR-4691-3p	CLIP-seq
MIRT873247	hsa-miR-485-5p	CLIP-seq
MIRT2196034	hsa-miR-498	CLIP-seq
MIRT873234	hsa-miR-516a-3p	CLIP-seq
MIRT873248	hsa-miR-539	CLIP-seq
MIRT873235	hsa-miR-628-5p	CLIP-seq
MIRT873222	hsa-miR-2115	CLIP-seq
MIRT873223	hsa-miR-2277-3p	CLIP-seq
MIRT873224	hsa-miR-3074-5p	CLIP-seq
MIRT873226	hsa-miR-3660	CLIP-seq
MIRT873227	hsa-miR-370	CLIP-seq
MIRT2385724	hsa-miR-3921	CLIP-seq
MIRT873228	hsa-miR-3977	CLIP-seq
MIRT873230	hsa-miR-4526	CLIP-seq
MIRT2385725	hsa-miR-4653-5p	CLIP-seq
MIRT873231	hsa-miR-4691-3p	CLIP-seq
MIRT873247	hsa-miR-485-5p	CLIP-seq
MIRT873234	hsa-miR-516a-3p	CLIP-seq
MIRT873235	hsa-miR-628-5p	CLIP-seq

Show/Hide all (5)

Transcription factor	Regulation	Reference
KLF2	Activation	22988032
NFKB1	Unknown	12745546;19469019;9840284
NR3C2	Activation	11751947
RELA	Unknown	12745546;19469019;9840284
YY1	Repression	12571248;15737629

Show/Hide all (64)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	IEP	12032188
GO:0001618	Function	Virus receptor activity	IEA
GO:0001618	Function	Virus receptor activity	TAS	10228019
GO:0002407	Process	Dendritic cell chemotaxis	TAS	16621978
GO:0003779	Function	Actin binding	IDA	12421915
GO:0004435	Function	Phosphatidylinositol-4,5-bisphosphate phospholipase C activity	TAS	8663314
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004950	Function	Chemokine receptor activity	IEA
GO:0004950	Function	Chemokine receptor activity	TAS	10201901
GO:0005515	Function	Protein binding	IPI	10816381, 12421915, 15001559, 15660419, 18230715, 18632580, 23235831, 23480650, 23597562, 24405750, 28381538, 30542158, 32296183
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	TAS	10415069
GO:0005768	Component	Endosome	IDA	10679098
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	10201901, 10393923
GO:0006816	Process	Calcium ion transport	IDA	8699119
GO:0006915	Process	Apoptotic process	IEA
GO:0006935	Process	Chemotaxis	IEA
GO:0006935	Process	Chemotaxis	TAS	10741397
GO:0006952	Process	Defense response	IEA
GO:0006954	Process	Inflammatory response	IBA
GO:0006954	Process	Inflammatory response	IEA
GO:0006954	Process	Inflammatory response	TAS	8639485
GO:0006955	Process	Immune response	IBA
GO:0006955	Process	Immune response	IEA
GO:0006955	Process	Immune response	TAS	8639485
GO:0006968	Process	Cellular defense response	TAS	10201901
GO:0007165	Process	Signal transduction	IEA
GO:0007166	Process	Cell surface receptor signaling pathway	IEA
GO:0007166	Process	Cell surface receptor signaling pathway	TAS	8639485
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IMP	19523456
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS	10393923
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IBA
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	TAS	10201901
GO:0007267	Process	Cell-cell signaling	IDA	10679098
GO:0009897	Component	External side of plasma membrane	IBA
GO:0009897	Component	External side of plasma membrane	IDA	10383387, 10679098, 11278962, 19523456
GO:0009897	Component	External side of plasma membrane	IEA
GO:0009986	Component	Cell surface	IDA	29739880
GO:0009986	Component	Cell surface	IDA	10521508
GO:0009986	Component	Cell surface	IEA
GO:0014808	Process	Release of sequestered calcium ion into cytosol by sarcoplasmic reticulum	IDA	19523456
GO:0015026	Function	Coreceptor activity	TAS	10469138
GO:0016020	Component	Membrane	IEA
GO:0016493	Function	C-C chemokine receptor activity	IBA
GO:0016493	Function	C-C chemokine receptor activity	IDA	8639485, 10383387, 11278962
GO:0016493	Function	C-C chemokine receptor activity	IEA
GO:0016493	Function	C-C chemokine receptor activity	NAS	8639485
GO:0019722	Process	Calcium-mediated signaling	IBA
GO:0019722	Process	Calcium-mediated signaling	IDA	10679098, 19523456
GO:0019957	Function	C-C chemokine binding	IEA
GO:0019957	Function	C-C chemokine binding	IPI	8699119, 10383387, 10679098
GO:0023052	Process	Signaling	IEP	12032188
GO:0042802	Function	Identical protein binding	IPI	18230715, 18632580, 23121557
GO:0046718	Process	Symbiont entry into host cell	IEA
GO:0060326	Process	Cell chemotaxis	IBA
GO:0070098	Process	Chemokine-mediated signaling pathway	IEA
GO:0070723	Process	Response to cholesterol	IMP	19523456
GO:0071222	Process	Cellular response to lipopolysaccharide	IEP	10679098
GO:0071345	Process	Cellular response to cytokine stimulus	IEA
GO:0071791	Function	Chemokine (C-C motif) ligand 5 binding	IBA
GO:0071791	Function	Chemokine (C-C motif) ligand 5 binding	IPI	8699119
GO:2000110	Process	Negative regulation of macrophage apoptotic process	IEA

MIM	HGNC	e!Ensembl
601373	1606	ENSG00000160791

P51681

Protein name

C-C chemokine receptor type 5 (C-C CKR-5) (CC-CKR-5) (CCR-5) (CCR5) (CHEMR13) (HIV-1 fusion coreceptor) (CD antigen CD195)

Protein function

Receptor for a number of inflammatory CC-chemokines including CCL3/MIP-1-alpha, CCL4/MIP-1-beta and RANTES and subsequently transduces a signal by increasing the intracellular calcium ion level. May play a role in the control of granulocytic lin

PDB

2L87 , 2MZX , 2RLL , 2RRS , 4MBS , 5UIW , 5YD3 , 5YD4 , 5YD5 , 5YY4 , 6FGP , 6MEO , 6MET , 7F1Q , 7F1R , 7F1S , 7NJZ , 7NW3 , 7O7F , 8AS2 , 8AS3

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	47 → 297	7 transmembrane receptor (rhodopsin family)	Family

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in spleen, thymus, in the myeloid cell line THP-1, in the promyeloblastic cell line KG-1a and on CD4+ and CD8+ T-cells. Medium levels in peripheral blood leukocytes and in small intestine. Low levels in ovary and lung.

Sequence

MDYQVSSPIYDINYYTSEPCQKINVKQIAARLLPPLYSLVFIFGFVGNMLVILILINCKR
LKSMTDIYLLNLAISDLFFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFII
LLTIDRYLAVVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQKEGLHYTCSS
HFPYSQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTI
MIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFV
GEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQEISVGL

Sequence length

352

Interactions

View interactions

	KEGG		Reactome
	Viral life cycle - HIV-1 Virion - Human immunodeficiency virus Cytokine-cytokine receptor interaction Viral protein interaction with cytokine and cytokine receptor Chemokine signaling pathway Endocytosis Toxoplasmosis Human cytomegalovirus infection Kaposi sarcoma-associated herpesvirus infection Human immunodeficiency virus 1 infection Viral carcinogenesis		Binding and entry of HIV virion Chemokine receptors bind chemokines G alpha (i) signalling events Interleukin-10 signaling

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (42)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Acquired immunodeficiency syndrome, delayed progression to	Conflicting classifications of pathogenicity; protective	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BEHCET SYNDROME	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CCR5 POLYMORPHISM, AFRICAN-AMERICAN	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CCR5 POLYMORPHISM, ORIENTAL 1	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CCR5 POLYMORPHISM, ORIENTAL 2	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CCR5 PROMOTER POLYMORPHISM	Conflicting classifications of pathogenicity; protective	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CCR5-related disorder	Benign; Conflicting classifications of pathogenicity; protective; Uncertain significance; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLONIC NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATITIS, ATOPIC	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES DUE TO AUTOIMMUNE PROCESS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES DUE TO IMMUNE MEDIATED PANCREATIC ISLET BETA-CELL DESTRUCTION	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, INSULIN-DEPENDENT	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, INSULIN-DEPENDENT, 22	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, KETOSIS-PRONE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GRANULOMATOSIS WITH POLYANGIITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATITIS B	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATITIS C	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatitis C virus, susceptibility to	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Human immunodeficiency virus type 1, increased perinatal transmission of	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IDIOPATHIC DIABETES	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
JUVENILE CHRONIC POLYARTHRITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY FAILURE, ACUTE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEISHMANIASIS, CUTANEOUS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MONOARTICULAR JUVENILE RHEUMATOID ARTHRITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MUCOCUTANEOUS LYMPH NODE SYNDROME	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple sclerosis modifier of disease progression	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PAUCIARTICULAR JUVENILE RHEUMATOID ARTHRITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Resistance to hepatitis C virus	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SARCOIDOSIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SARCOIDOSIS, PULMONARY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SICCA SYNDROME	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SJOGRENS SYNDROME	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Susceptibility to HIV infection	Benign; protective; Conflicting classifications of pathogenicity; Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Type 1 diabetes mellitus 22	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UVEITIS, POSTERIOR	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
West Nile virus, susceptibility to	Benign; Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (477)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acne	Acne	BEFREE	14759987		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	28276569		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Kidney Insufficiency	Acute Kidney Insufficiency	CTD_human_DG	26055553		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute leukemia	Leukemia	BEFREE	24819208		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	29868623		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	16161154, 17653092		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	17653092		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	16614115		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoid Cystic Carcinoma	Adenocarcinoma	BEFREE	29549020		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	30309853, 30836379		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aggressive Periodontitis	Aggressive Periodontitis	BEFREE	25119558, 28969941		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	15743889, 9665462	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	BEFREE	15488313		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia Sickle Cell	Sickle cell anemia	Pubtator	25548430, 28671257, 32267841	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	12532229, 16305685, 28671257, 31030250		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anodontia	Anodontia	Pubtator	36675305	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	31432181		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anthracosis	Anthracosis	BEFREE	16524739		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	15557916	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	15557916, 19476483, 27533781		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	LHGDN	15557916		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic Valve Insufficiency	BEFREE	30871130		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arterial Occlusive Diseases	Arterial Occlusive Disease	BEFREE	15557916		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arterial Occlusive Diseases	Arterial Occlusive Disease	LHGDN	15557916		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arterial Occlusive Diseases	Arterial occlusive disease	Pubtator	15557916, 19874552	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	16055130, 16803997, 18436884, 19874552, 20130232, 21133894, 21846359, 27118566, 27898058, 29417414, 29500407, 30778913, 30968058		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	10323454, 11160301, 16541097, 17178563, 17363330, 20153665, 20811274, 30053832		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	10323454, 16107514, 29880013	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Juvenile	Juvenile arthritis	Pubtator	10765921, 16775617, 17374135, 21739422	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	10323455, 11352233, 11762935, 12699431, 15140775, 15331395, 16775617, 16838043, 19538721, 19740335, 19804625, 22479344, 22665517, 28866647, 30091955, 36311761 View all (1 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	15361394	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	20153665		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthropathy	Arthropathy	BEFREE	10323454		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	10520641, 11081537, 11447384, 12437612, 12612298, 14607956, 18972295, 23250822, 23454776, 24171669		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	12612298, 19223978, 19520154, 20220260, 23760409, 35751199	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	LHGDN	17445875, 18972295		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Astrocytoma	Astrocytoma	BEFREE	16022659, 17391642		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	30554073	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	16055130, 16803997, 18436884, 19874552, 20130232, 21133894, 21846359, 27118566, 27898058, 29417414, 29500407, 30778913, 30968058		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	LHGDN	16055130		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	18511806, 19874552, 27177313, 30778913	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrophy	Atrophy	Pubtator	14704722	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	11966764, 17971457, 28086002, 28777108, 29163468, 29182645, 31243152		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	18511806, 25180533, 28086002, 29182645	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune thyroiditis	Autoimmune Thyroiditis	BEFREE	27894748		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	10068655, 29456131		★★★★★ ★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	14651522, 15009175, 15654837, 17067435, 22966075, 24171669, 25268662, 26393284		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Behcet Syndrome	Behcet disease	Pubtator	15196263, 15654837, 22966075, 24984193	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Behcet Syndrome	Behcet Syndrome	LHGDN	17067435		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Benign Neoplasm	Benign Neoplasm	BEFREE	24301790		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	23632061		★★★★★ ★☆☆☆☆ Found in Text Mining only
Berylliosis	Berylliosis	Pubtator	20075058	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
beta Thalassemia	Beta thalassemia	Pubtator	27526959	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar disorder	Pubtator	25487697	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	30867081		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	22982413, 24430363		★★★★★ ★☆☆☆☆ Found in Text Mining only
Blood Platelet Disorders	Platelet disorder	Pubtator	30029921	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone Disease	BEFREE	21403648		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain atrophy	Brain atrophy	BEFREE	17671738		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	12244149	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Brain ischemia	Pubtator	15004773	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Cerebral Ischemia	BEFREE	28294064		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	14597737, 19212663, 22380870, 22637726, 22994752, 23078970, 24301790, 25171476, 25716470, 27863423, 28693495, 29216863, 29299159, 29358169, 30456574, 30848448, 31691056, 31705019 View all (3 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	14597737, 16518599, 22380870, 23078970, 23543442, 25171476, 33245226, 33671956, 34907035, 35120331, 35606863, 37222841, 40395152	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchiolitis	Bronchiolitis	BEFREE	12964123		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchiolitis	Bronchiolitis	LHGDN	12964123		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	31011147, 39549571	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	11156420, 15708547		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Adenoid Cystic	Adenoid cystic carcinoma	Pubtator	29549020	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	15180734	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	32170378, 32730361, 38552222	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	22982413, 24430363		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	17926037	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	31432181, 40269781	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	16863511	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	11703822, 22537745, 25312802, 29922960, 30180856		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	30180856	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	18436884, 20130232, 21133894, 21846359, 26222902		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	LHGDN	18436884		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	19389855, 21846359, 36035865	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	BEFREE	15557916		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	Pubtator	15557916, 18060801	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	11465714	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
CATARACT, ANTERIOR POLAR	Cataract	BEFREE	23107763		★★★★★ ★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	27894748		★★★★★ ★☆☆☆☆ Found in Text Mining only
Central Nervous System Diseases	Central nervous system disease	Pubtator	15194768	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral atrophy	Cerebral Atrophy	BEFREE	17671738		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	22769019	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	28294064		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	19874552, 22769019, 30794775		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular Disorders	BEFREE	19874552		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular disorder	Pubtator	19874552	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	17094383, 18543610, 31151412		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	31151412		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	17094383, 18543610, 31151412		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chagas Cardiomyopathy	Chagas cardiomyopathy	Pubtator	23150742, 29160519, 30650073	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chagas Disease	Chagas disease	Pubtator	26599761, 30650073	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	33045415	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangitis, Sclerosing	Cholangitis	BEFREE	15215889		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangitis, Sclerosing	Cholangitis	LHGDN	15215889		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholecystolithiasis	Cholecystolithiasis	BEFREE	18405329		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholelithiasis	Cholelithiasis	BEFREE	18405329		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	BEFREE	15389872		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	Pubtator	24047437	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	11200816		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	15610230, 16395252, 19196047, 21132346, 22348061, 27118566		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	17428349, 27118566		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Insufficiency	Renal Insufficiency	BEFREE	17428349		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	17640964, 22990623, 24742278, 28053515, 29907106		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	LHGDN	17640964		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	BEFREE	17305874, 20059422, 28969941		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ciliary Motility Disorders	Ciliary dyskinesia	Pubtator	29116124	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	BEFREE	12021361, 29729320		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	11393656, 29037608		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	31356607	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	22205974, 30429227		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	20054600, 25671296, 25840792, 31428524		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	15856455		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	25671296, 29606345, 30411783, 30554073, 33893084, 38212126	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Common Variable Immunodeficiency	Common variable immunodeficiency	Pubtator	26684629, 29083052	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital thrombotic disease due to Protein C deficiency	Congenital thrombotic thrombocytopenic purpura	Pubtator	18989363	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	15301862		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Aneurysm	Coronary Aneurysm	BEFREE	18629619		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	15017357, 16055130, 17383752, 20182805, 23312573, 27013693		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	12742282, 15017357, 15302103, 16055130, 17383752, 20182805, 23312573, 27013693		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	12742282, 20628649, 39512689, 39600283	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	24118494	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	27013693	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	15017357, 16055130, 17383752, 18220812, 18629619, 20182805, 23312573, 27013693		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	LHGDN	16055130		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	11141322, 11377705, 11393656, 15215889, 15492753		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	12699425	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	19679608, 28273887	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cryoglobulinemia	Cryoglobulinemia	BEFREE	30214525		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cryptosporidiosis	Cryptosporidiosis	Pubtator	12010355	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	25245091, 30177416		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	11352237, 15389872, 20811274, 27965260		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	15717264		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	Pubtator	9971818	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Demyelinating Diseases	Demyelinating diseases	Pubtator	11696431	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Demyelinating Diseases	Demyelinating Diseases	BEFREE	16182378		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	34291627	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive Disorder Major	Major depressive disorder	Pubtator	32917850	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	CTD_human_DG	18249437		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Deuteranomaly	Deuteranomaly	BEFREE	20075058		★★★★★ ★☆☆☆☆ Found in Text Mining only
Developmental regression	Developmental regression	BEFREE	28650342		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	14583186, 24433479		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	14583186, 18444795, 24433479, 27118566, 29091208		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	18803760, 30184318	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	28454543, 37773841	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	12688247, 35638288	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	32880687	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	17428349, 30884193, 35936218, 36674502, 39600283	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	10400139, 11334429, 12145160, 12688247, 12770795, 14583186, 15135805, 16249462, 17130553, 17604289, 24171669, 27619405, 27894748, 30420202		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, INSULIN-DEPENDENT, 22 (disorder)	Diabetes Mellitus	CTD_human_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	11756347, 12610055, 14583186, 16442182, 17428349, 19744740, 21127830, 23250822, 24433479, 27898058, 30884193		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	19357773	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	24786705	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	11756347, 12610055, 16249462, 16442182, 19357773, 20203694, 22325341, 24433479, 25280384		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	LHGDN	16249462		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	27619405		★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	25222269		★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	25222269	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dry Eye Syndromes	Dry Eye Syndromes	BEFREE	16682594		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dry Eye Syndromes	Dry eye syndrome	Pubtator	36522768	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	30420202		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eczema, Infantile	Eczema	CTD_human_DG	18249437		★★★★★ ★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	BEFREE	15288441, 26906062, 31119711		★★★★★ ★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	LHGDN	18179389		★★★★★ ★☆☆☆☆ Found in Text Mining only
End Stage Liver Disease	End Stage Liver Disease	BEFREE	22146622		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	36675305	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	14981141, 31427176		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsies Partial	Partial epilepsy	Pubtator	26599761	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	26028088		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	26028088		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	32457351	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	12680626		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial Primary Pulmonary Hypertension	Pulmonary hypertension	Pubtator	32159364	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	23661906, 29448843, 31416250		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver, Alcoholic	Alcoholic Fatty Liver	BEFREE	27859576		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibroadenoma	Fibroadenoma	BEFREE	24301790		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	19603542, 23515570, 23661906, 27639593, 29336497, 31416250		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fleck corneal dystrophy	Fleck Corneal Dystrophy	BEFREE	29162878		★★★★★ ★☆☆☆☆ Found in Text Mining only
Focal Cortical Dysplasia	Focal cortical dysplasia	Pubtator	29162878	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	18405329		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	18405329	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallstones	Gallstones	Pubtator	18405329	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gaucher Disease	Gaucher Disease	BEFREE	25245091		★★★★★ ★☆☆☆☆ Found in Text Mining only
Genital ulcers	Genital ulcers	BEFREE	18008231		★★★★★ ★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant Cell Arteritis	BEFREE	15572394, 21354457, 23001713		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	16022659, 17391642, 22425022, 28279751, 31747383		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	32545571, 35464424	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	16022659, 17391642, 22425022, 28279751, 31747383		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	17066899, 17849315, 31649684	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	17849315, 28279751		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	Pubtator	10469367, 11012889	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	15610230	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	15812393	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	18814951, 20025985, 29061535, 31442594, 38457490	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	17145599, 17984846, 25532439, 28057639, 28487238, 29061535, 29128556, 31312356, 31461746		★★★★★ ★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	LHGDN	17145599		★★★★★ ★☆☆☆☆ Found in Text Mining only
Granulomatosis with Polyangiitis	Granulomatosis with polyangiitis	Pubtator	12716450	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Granulomatosis with polyangiitis	Granulomatosis With Polyangiitis	BEFREE	12858455, 12865065, 15675141		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Granulomatosis with Polyangiitis	Granulomatosis with polyangiitis	Pubtator	22490506, 27624647	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Graves Disease	Graves Disease	BEFREE	11966764		★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves disease	Pubtator	11966764	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto disease	Pubtator	27872865, 35720300	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	BEFREE	27894748		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	18386165		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	18386165	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	11703822, 30650073, 31087713		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	15301862		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	32159364	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	28487238		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemophilia A	Hemophilia	BEFREE	11091193, 14673528, 19172482, 19811439, 8791590, 9562872, 9806051		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemophilia, NOS	Hemophilia	BEFREE	11091193, 19172482, 19811439, 8791590, 9562872, 9806051		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemorrhagic Fever with Renal Syndrome	Hemorrhagic fever with renal syndrome	Pubtator	31340562	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatic Encephalopathy	Hepatic encephalopathy	Pubtator	34938356	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	17079285	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatitis C	Hepatitis c	Pubtator	20710056, 28387899	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatitis C Chronic	Hepatitis c	Pubtator	22577869	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Leiomyomatosis and Renal Cell Cancer	Hereditary Leiomyomatosis and Renal Cancer	BEFREE	17214851		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	11238088, 29456131, 30309853, 30836379		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	11238088	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperandrogenism	Hyperandrogenism	Pubtator	34119324	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperhomocysteinemia	Hyperhomocysteinemia	BEFREE	23107763		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	LHGDN	17112859		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	BEFREE	29794461		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypersensitivity Delayed	Hypersensitivity	Pubtator	21288827	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	22769019	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	26873938, 27118566, 31320454		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypotension	Hypotension	Pubtator	25487697, 29927949	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	22380870, 30778913	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ichthyosis linearis circumflexa	Netherton syndrome	BEFREE	12055576		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	24993099, 31320454		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	15802346	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	37544465	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	15610230, 16395252		★★★★★ ★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	LHGDN	15610230, 16395252		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	19479371, 31730458		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	19479371, 31522438, 31730458	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune thrombocytopenic purpura	Immune Thrombocytopenic Purpura	BEFREE	23494742		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	10479136, 10639161, 10662618, 10786999, 11023494, 11091193, 11181160, 11884536, 12186908, 12396109, 15625621, 16022659, 16648135, 16778803, 17005802 View all (10 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	11141322, 11156639, 11354628, 11378820, 11393656, 15215889, 16633049, 18647548, 28140695, 29375583		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	15306587, 16909434	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	34119324, 39600283	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Intellectual developmental disorder	Pubtator	21288827	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	14704722	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	15654837	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	19874552		★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	BEFREE	10765921, 15743472, 16775617, 17565662, 18189189, 20463745, 22638733		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kallmann Syndrome	Kallmann syndrome	Pubtator	22102307	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	10446961, 9323208		★★★★★ ★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	Pubtator	37001853	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	11756347, 12610055, 16442182, 19357773, 23250822, 24433479		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	14742268	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	19357773	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure	Kidney Failure	BEFREE	17428349, 22348061		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	15610230, 16395252, 19389855, 19679608	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	28651949	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	CTD_human_DG	26055553		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Failure, Chronic	Kidney Failure	BEFREE	15610230, 16395252, 19196047, 21132346, 22348061, 27118566		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	LHGDN	15610230		★★★★★ ★☆☆☆☆ Found in Text Mining only
Latent Autoimmune Diabetes in Adults	Autoimmune Diabetes	BEFREE	12770795		★★★★★ ★☆☆☆☆ Found in Text Mining only
Left ventricular systolic dysfunction	Ventricular Systolic Dysfunction	BEFREE	26599761		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	BEFREE	14632750		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	LHGDN	15902300		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	18842429	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	28028680, 28751153, 29481882, 31636630, 31669202		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Hairy Cell	Hairy cell leukemia	Pubtator	15001469	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	19213682, 31740623	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Large Granular Lymphocytic	Lymphoblastic Leukemia	BEFREE	15902300		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Mast-Cell	Leukemia	BEFREE	17214851		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	19213682, 30548022, 30836379		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	20729133		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	17413295, 18205260, 22374185, 23326556, 31416250		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	19603542		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	20548789, 30239650	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	20548789	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure Acute	Liver failure	Pubtator	22837127	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure, Acute	Liver failure	BEFREE	22550960		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	14514472		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	14514472, 20075058	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	LHGDN	19017998		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	18383361, 35216350	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	19309748, 32549766	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	17971457		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	17971457, 23298254, 32214033	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	17971457		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	12913933, 17971457, 19811270, 23832290, 25167769, 26071874		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	12913933, 17971457, 19811270, 20682662, 24720467, 25167769		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	LHGDN	12913933, 17585540		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	17971457	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	17971457		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	20054600		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	22380870	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphohistiocytosis Hemophagocytic	Hemophagocytic lymphohistiocytosis	Pubtator	32356861	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	18842429	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	21505069, 23478911, 29456131		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	35887224	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	20038229		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Large-Cell, Follicular	Lymphoma	BEFREE	10068655, 20038229		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	10068655, 10446961, 20038229		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	10068655, 20038229		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative syndrome	Pubtator	34119324	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	30894217	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	35352887	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Cystosarcoma Phyllodes	Cystosarcoma Phyllodes	BEFREE	30890553		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	18386165		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	14597737, 19212663, 22380870, 22637726, 22994752, 23078970, 24301790, 25171476, 25716470, 27863423, 28693495, 29216863, 29299159, 29358169, 30456574, 30848448, 31691056, 31705019 View all (3 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	26028088		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	18405329		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	20729133		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	19155524, 29358632		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	16161154, 19250219, 21827290, 22612293, 23632061, 24604010		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	22982413, 24430363		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10446961, 15708547, 17460174, 18405329, 19155524, 21091093, 21468700, 22085486, 22380870, 24687549, 25172974, 26028088, 27262929, 28345004, 28416485 View all (10 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	17094383, 18543610, 31151412		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	22205974, 30429227		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	14597737		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	16161154, 25171476, 29216863		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	17214851		★★★★★ ★☆☆☆☆ Found in Text Mining only
Megalencephaly cutis marmorata telangiectatica congenita	Megalencephaly Cutis Marmorata Telangiectatica Congenita	BEFREE	22494179		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	17909797		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	17909797, 24129241	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	28382399, 29089297, 30474221		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	32002296	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	31983065	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	27898058		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	27013693	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	17296858		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	17909797, 24129241, 31785018		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	25452256		★★★★★ ★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	BEFREE	19116725, 21820915		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitral Valve Stenosis	Mitral Valve Stenosis	BEFREE	9438209		★★★★★ ★☆☆☆☆ Found in Text Mining only
Moyamoya Disease	Moyamoya Disease	BEFREE	28072843		★★★★★ ★☆☆☆☆ Found in Text Mining only
Moyamoya disease 1	Moyamoya disease	BEFREE	28072843		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	BEFREE	15962231, 17672867, 18629619, 20628649		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	LHGDN	15962231		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	15962231, 17672867, 20628649	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mucosa-Associated Lymphoid Tissue Lymphoma	Mucosa-associated lymphoma	BEFREE	18385779		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	LHGDN	12200385		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	15730850, 21403648		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	15730850, 16542368	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	10359806, 11966770	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple Sclerosis	BEFREE	10626673, 10803840, 11086101, 11108946, 12021948, 12270649, 12874407, 14616291, 15080861, 15124759, 15354329, 15956159, 16182378, 17351762, 17503665 View all (14 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple sclerosis	Pubtator	11696431, 17257590, 18511806, 19479371, 19666086, 22479344, 23202893, 27346865, 30759186, 34596589	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple Sclerosis	LHGDN	11966770, 12451219, 17351762, 17671738		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Muscular Dystrophy, Duchenne	Duchenne Muscular Dystrophy	BEFREE	29561896		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia Gravis	BEFREE	14533004		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	11477473, 17383752, 18220812, 20182805, 22285384, 24293156, 27013693		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	LHGDN	18379014		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	LHGDN	15950936		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myositis Inclusion Body	Myositis	Pubtator	28086002, 32259312	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
MYOTONIC DYSTROPHY 1	Myotonic dystrophy	BEFREE	18444795, 29091208		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myxoma of heart	Myxoma Of Heart	BEFREE	26134542		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myxoma of the Endocardium	Myxoma Of The Endocardium	BEFREE	26134542		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	22226739	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	12097285, 14597737, 16863511, 17094383, 19155524, 20054600, 21403648, 22282655, 22425022, 22735807, 24129241, 24301790, 25452256, 25716470, 26134542 View all (18 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephritis	Nephritis	CTD_human_DG	26055553		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephritis, Interstitial	Nephritis	BEFREE	9853259		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephritis, Tubulointerstitial	Nephritis	BEFREE	9853259		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nervous System Diseases	Nervous system disease	Pubtator	23916293	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	19390328		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	10820198, 14644028, 17391642		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	10820198, 16001969	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	31972607	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	30658114		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	17116220		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	31416250		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nuclear non-senile cataract	Cataract	BEFREE	12055576		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	23760409, 28454543, 28903065, 28963085, 32188105	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	24895488, 27677832	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	27898058, 29280303		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oculocutaneous albinism type 1A	Oculocutaneous albinism	BEFREE	21191639		★★★★★ ★☆☆☆☆ Found in Text Mining only
Optic Neuritis	Optic Neuritis	LHGDN	11966770		★★★★★ ★☆☆☆☆ Found in Text Mining only
Optic Neuritis	Optic neuritis	Pubtator	11966770	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	11352237, 39236430	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteomyelitis	Osteomyelitis	BEFREE	25638273		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	29263385		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	37361541	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	22506069	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	25330803		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	19351767, 24762504, 28868628, 36597144, 37800814	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	19155524, 29358632		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	29358632	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Papilloma	Papilloma	BEFREE	28904130		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	15488313		★★★★★ ★☆☆☆☆ Found in Text Mining only
Patent ductus arteriosus	Patent ductus arteriosus	BEFREE	31266770		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pauci-immune Glomerulonephritis associated with Granulomatosis with Polyangiitis	Granulomatosis with polyangiitis	BEFREE	12858455, 12865065, 15675141		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pemphigus Benign Familial	Benign familial pemphigus	Pubtator	21592988	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	BEFREE	14697747		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	14697747, 17305874, 25119558, 28969941		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pleural effusion disorder	Pleural effusion	BEFREE	22806538		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	34119324	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	29868623		★★★★★ ★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	15717264		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	15566517, 16721228		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary sclerosing cholangitis	Sclerosing Cholangitis	BEFREE	11492971, 15215889, 16633049, 16774544, 21134114		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	16161154, 19250219, 21827290, 22612293, 23632061, 24604010		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	16161154, 19064579		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	28903065	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	28903065	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pseudohyperkalemia Cardiff	Pseudohyperkalemia Cardiff	BEFREE	29664712		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	11310827, 17647003, 20153665, 27068801		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis vulgaris	Psoriasis vulgaris	BEFREE	29145242, 31148855		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	24993099		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	18727632, 19229703, 25775429, 29907106	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	24742278, 28053515	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	26965295, 28494757, 28963085, 37200921	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal glomerular disease	Renal Glomerular Disease	BEFREE	10469367		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	17428349		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	LHGDN	17428349		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	27619405		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	10323455, 11196706, 12699431, 12846056, 14596426, 15004722, 15067318, 15331395, 15361394, 16541097, 16775617, 17503665, 17604289, 17963165, 18189189 View all (14 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	16541097, 19017998		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rhinitis Allergic	Rhinitis	Pubtator	17982926	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	BEFREE	10988120, 11803051, 15976369, 18311470, 20075058		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoidosis	Sarcoidosis	Pubtator	15802346	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoidosis	Sarcoidosis	LHGDN	15976369		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoidosis	Sarcoidosis	Pubtator	20075058, 34440736	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoidosis Pulmonary	Sarcoidosis	Pubtator	19679608	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	16513874, 26906930		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	16513874		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	LHGDN	18295459		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	25487697	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Scleroderma Systemic	Systemic sclerosis	Pubtator	18383361, 35216350	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	29606345, 30411783, 30554073		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sensory neuropathy	Sensory neuropathy	BEFREE	29239897		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	34925370	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	30724784		★★★★★ ★☆☆☆☆ Found in Text Mining only
Severe Combined Immunodeficiency	Severe combined immunodeficiency disease	BEFREE	31099257		★★★★★ ★☆☆☆☆ Found in Text Mining only
Situs Inversus	Situs Inversus	BEFREE	10458756, 21035160, 26109719, 29173179, 29925666		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	34386009	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	27068801, 28518224		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	30778913	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	30778913		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	24301940, 28904130		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	29705397		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	20622890, 31011147, 32079256, 36167571	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	28904130		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	22085486, 31011147		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	29760499, 30179264		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	21091093	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	22769019, 34291627, 36380716, 38457490	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	22769019	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sweet Syndrome	Sweet Syndrome	BEFREE	28518224		★★★★★ ★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	BEFREE	20463745		★★★★★ ★☆☆☆☆ Found in Text Mining only
T-Cell Large Granular Lymphocyte Leukemia	T-cell Lymphocytic Leukemia	BEFREE	17875534		★★★★★ ★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	26928433		★★★★★ ★☆☆☆☆ Found in Text Mining only
TARSAL-CARPAL COALITION SYNDROME	Tarsal-Carpal Coalition Syndrome	BEFREE	19646633		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Thyroid Diseases	BEFREE	27894748		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroiditis	Thyroiditis	Pubtator	11966764	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Transient Ischemic Attack	Transient Ischemic Attack	BEFREE	19874552		★★★★★ ★☆☆☆☆ Found in Text Mining only
Trigeminal Neuralgia	Trigeminal neuralgia	Pubtator	34067581	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	28693495, 31747383		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	34717291	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	11141322, 11378820, 11393656, 15215889, 31356607		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urticaria	Urticaria	BEFREE	23727176		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	31151412	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	17094383, 31151412	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	31151412	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveitis	Uveitis	Pubtator	15196263	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveitis Anterior	Anterior uveitis	Pubtator	15043537	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveitis Posterior	Uveitis	Pubtator	17417600	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	19874552, 22314435		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	19874552	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	Pubtator	12716450, 39186910	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	BEFREE	15572394		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	LHGDN	15962231		★★★★★ ★☆☆☆☆ Found in Text Mining only
Venous Thromboembolism	Venous thromboembolism	Pubtator	19263529	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ventricular Dysfunction	Ventricular dysfunction	Pubtator	23150742	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vesicular Stomatitis	Vesicular Stomatitis	BEFREE	17681018		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vestibular Neuronitis	Vestibular neuritis	Pubtator	11966770	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	BEFREE	19129082, 28385330, 29115683		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	Pubtator	34516831	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
VITILIGO-ASSOCIATED MULTIPLE AUTOIMMUNE DISEASE SUSCEPTIBILITY 1 (finding)	Vitiligo-associated SYSTEMIC LUPUS ERYTHEMATOSUS	BEFREE	19129082, 28385330, 29115683		★★★★★ ★☆☆☆☆ Found in Text Mining only

CCR5 (C-C motif chemokine receptor 5)