CCR1 (C-C motif chemokine receptor 1)

Gene

• Entrez ID: 1230
• Gene name: C-C motif chemokine receptor 1
• Gene symbol: CCR1
• Synonyms (NCBI Gene): CD191, CKR-1, CKR1, CMKBR1, HM145, MIP1aR, SCYAR1
• Chromosome: 3
• Chromosome location: 3p21.31
• Summary: This gene encodes a member of the beta chemokine receptor family, which is predicted to be a seven transmembrane protein similar to G protein-coupled receptors. The ligands of this receptor include macrophage inflammatory protein 1 alpha (MIP-1 alpha), re

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT005956	hsa-miR-21-5p	Luciferase reporter assay	21131358
MIRT733201	hsa-miR-191-5p	ELISA, qRT-PCR, Western blotting	33420627
MIRT873169	hsa-miR-1207-5p	CLIP-seq
MIRT873170	hsa-miR-1208	CLIP-seq
MIRT873171	hsa-miR-1254	CLIP-seq
MIRT873172	hsa-miR-1289	CLIP-seq
MIRT873173	hsa-miR-135a	CLIP-seq
MIRT873174	hsa-miR-135b	CLIP-seq
MIRT873175	hsa-miR-197	CLIP-seq
MIRT873176	hsa-miR-3065-5p	CLIP-seq
MIRT873177	hsa-miR-3116	CLIP-seq
MIRT873178	hsa-miR-3190	CLIP-seq
MIRT873179	hsa-miR-3198	CLIP-seq
MIRT873180	hsa-miR-34b	CLIP-seq
MIRT873181	hsa-miR-34c-3p	CLIP-seq
MIRT873182	hsa-miR-3653	CLIP-seq
MIRT873183	hsa-miR-3658	CLIP-seq
MIRT873184	hsa-miR-3940-5p	CLIP-seq
MIRT873185	hsa-miR-4294	CLIP-seq
MIRT873186	hsa-miR-4302	CLIP-seq
MIRT873187	hsa-miR-4309	CLIP-seq
MIRT873188	hsa-miR-4318	CLIP-seq
MIRT873189	hsa-miR-4507	CLIP-seq
MIRT873190	hsa-miR-4704-3p	CLIP-seq
MIRT873191	hsa-miR-4736	CLIP-seq
MIRT873192	hsa-miR-4757-5p	CLIP-seq
MIRT873193	hsa-miR-4763-3p	CLIP-seq
MIRT873194	hsa-miR-4790-3p	CLIP-seq
MIRT873195	hsa-miR-487a	CLIP-seq
MIRT873196	hsa-miR-501-3p	CLIP-seq
MIRT873197	hsa-miR-502-3p	CLIP-seq
MIRT873198	hsa-miR-550a	CLIP-seq
MIRT873199	hsa-miR-648	CLIP-seq
MIRT873200	hsa-miR-661	CLIP-seq
MIRT873201	hsa-miR-759	CLIP-seq
MIRT1959076	hsa-miR-3170	CLIP-seq
MIRT1959077	hsa-miR-4323	CLIP-seq
MIRT2196016	hsa-miR-134	CLIP-seq
MIRT2196017	hsa-miR-223	CLIP-seq
MIRT2196018	hsa-miR-3118	CLIP-seq
MIRT2196019	hsa-miR-3164	CLIP-seq
MIRT873186	hsa-miR-4302	CLIP-seq
MIRT2196020	hsa-miR-4687-3p	CLIP-seq
MIRT2196021	hsa-miR-4697-3p	CLIP-seq
MIRT2677602	hsa-miR-1227	CLIP-seq
MIRT2196016	hsa-miR-134	CLIP-seq
MIRT2677603	hsa-miR-3064-5p	CLIP-seq
MIRT2196018	hsa-miR-3118	CLIP-seq
MIRT2196019	hsa-miR-3164	CLIP-seq
MIRT2677604	hsa-miR-3652	CLIP-seq
MIRT1959077	hsa-miR-4323	CLIP-seq
MIRT2677605	hsa-miR-4430	CLIP-seq
MIRT2677606	hsa-miR-4480	CLIP-seq
MIRT2677607	hsa-miR-4505	CLIP-seq
MIRT2677608	hsa-miR-4786-3p	CLIP-seq
MIRT2677609	hsa-miR-490-3p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
STAT1	Activation	16628196

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002407	Process	Dendritic cell chemotaxis	TAS	16621978
GO:0002548	Process	Monocyte chemotaxis	IDA	29930254
GO:0004435	Function	Phosphatidylinositol-4,5-bisphosphate phospholipase C activity	IDA	10734056
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004950	Function	Chemokine receptor activity	IDA	10660125
GO:0004950	Function	Chemokine receptor activity	IEA
GO:0004950	Function	Chemokine receptor activity	TAS	10770925
GO:0005515	Function	Protein binding	IPI	8699119, 15001559, 15474493, 28381538, 32296183, 33961781
GO:0005737	Component	Cytoplasm	IBA
GO:0005886	Component	Plasma membrane	IDA	10660125, 15474493, 18587271
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	IMP	15001559
GO:0005886	Component	Plasma membrane	TAS	7505609
GO:0006816	Process	Calcium ion transport	IDA	10734056
GO:0006874	Process	Intracellular calcium ion homeostasis	IDA	10734056
GO:0006887	Process	Exocytosis	IDA	10734056
GO:0006935	Process	Chemotaxis	IEA
GO:0006935	Process	Chemotaxis	NAS	15474493
GO:0006954	Process	Inflammatory response	IBA
GO:0006954	Process	Inflammatory response	IDA	10443688, 10748004
GO:0006954	Process	Inflammatory response	IEA
GO:0006954	Process	Inflammatory response	TAS	7683036
GO:0006955	Process	Immune response	IBA
GO:0006955	Process	Immune response	IDA	10734056
GO:0006955	Process	Immune response	IEA
GO:0007155	Process	Cell adhesion	TAS	10910894
GO:0007165	Process	Signal transduction	IEA
GO:0007166	Process	Cell surface receptor signaling pathway	IEA
GO:0007166	Process	Cell surface receptor signaling pathway	TAS	10770925
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007187	Process	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger	TAS	7505609
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IBA
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IDA	10734056
GO:0007249	Process	Canonical NF-kappaB signal transduction	IDA	1406630, 9346484, 10882101, 25038658, 34721373
GO:0007267	Process	Cell-cell signaling	IDA	10734056
GO:0009611	Process	Response to wounding	TAS	7505609
GO:0009897	Component	External side of plasma membrane	IBA
GO:0009897	Component	External side of plasma membrane	IDA	10706735
GO:0010629	Process	Negative regulation of gene expression	IMP	21403648
GO:0016020	Component	Membrane	IEA
GO:0016493	Function	C-C chemokine receptor activity	IBA
GO:0016493	Function	C-C chemokine receptor activity	IDA	10734056
GO:0016493	Function	C-C chemokine receptor activity	IEA
GO:0019221	Process	Cytokine-mediated signaling pathway	NAS	15474493
GO:0019722	Process	Calcium-mediated signaling	IBA
GO:0019957	Function	C-C chemokine binding	IPI	7545673, 8699119, 10660125, 15764707
GO:0023019	Process	Signal transduction involved in regulation of gene expression	IDA	1406630, 9346484, 25038658, 34721373
GO:0030335	Process	Positive regulation of cell migration	IMP	24056371
GO:0030502	Process	Negative regulation of bone mineralization	IMP	21403648
GO:0035717	Function	Chemokine (C-C motif) ligand 7 binding	IBA
GO:0035717	Function	Chemokine (C-C motif) ligand 7 binding	IPI	7545673, 10660125
GO:0045672	Process	Positive regulation of osteoclast differentiation	IMP	21403648
GO:0050729	Process	Positive regulation of inflammatory response	IDA	23125416
GO:0050729	Process	Positive regulation of inflammatory response	IDA	23125416, 38417634
GO:0050729	Process	Positive regulation of inflammatory response	TAS	23125416
GO:0051928	Process	Positive regulation of calcium ion transport	IDA	15764707
GO:0060326	Process	Cell chemotaxis	IBA
GO:0070098	Process	Chemokine-mediated signaling pathway	IDA	21403648, 23276697
GO:0070098	Process	Chemokine-mediated signaling pathway	ISS
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IMP	21403648
GO:0071345	Process	Cellular response to cytokine stimulus	IEA
GO:0071791	Function	Chemokine (C-C motif) ligand 5 binding	IBA
GO:0071791	Function	Chemokine (C-C motif) ligand 5 binding	IPI	7545673, 8699119, 10660125, 10734056
GO:0090026	Process	Positive regulation of monocyte chemotaxis	IDA	18587271
GO:0090026	Process	Positive regulation of monocyte chemotaxis	IEA
GO:0150078	Process	Positive regulation of neuroinflammatory response	IDA	24854121
GO:0150078	Process	Positive regulation of neuroinflammatory response	ISS
GO:0150078	Process	Positive regulation of neuroinflammatory response	ISS
GO:1900016	Process	Negative regulation of cytokine production involved in inflammatory response	IDA	16968406

Other IDs

• MIM: 601159
• HGNC: 1602
• e!Ensembl: ENSG00000163823

Protein

• UniProt ID: P32246
• Protein name: C-C chemokine receptor type 1 (C-C CKR-1) (CC-CKR-1) (CCR-1) (CCR1) (HM145) (LD78 receptor) (Macrophage inflammatory protein 1-alpha receptor) (MIP-1alpha-R) (RANTES-R) (CD antigen CD191)
• Protein function: Chemokine receptor that plays a crucial role in regulating immune cell migration, inflammation, and immune responses (PubMed:14991608). Contributes to the inflammatory response by recruiting immune cells, such as monocytes, macrophages, T-cells,
• PDB: 7VL8, 7VL9, 7VLA
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	51 → 301	7 transmembrane receptor (rhodopsin family)	Family

• Tissue specificity: TISSUE SPECIFICITY: Widely expressed in different hematopoietic cells.
• Sequence:

  METPNTTEDYDTTTEFDYGDATPCQKVNERAFGAQLLPPLYSLVFVIGLVGNILVVLVLV
  QYKRLKNMTSIYLLNLAISDLLFLFTLPFWIDYKLKDDWVFGDAMCKILSGFYYTGLYSE
  IFFIILLTIDRYLAIVHAVFALRARTVTFGVITSIIIWALAILASMPGLYFSKTQWEFTH
  HTCSLHFPHESLREWKLFQALKLNLFGLVLPLLVMIICYTGIIKILLRRPNEKKSKAVRL
  IFVIMIIFFLFWTPYNLTILISVFQDFLFTHECEQSRHLDLAVQVTEVIAYTHCCVNPVI
  YAFVGERFRKYLRQLFHRRVAVHLVKWLPFLSVDRLERVSSTSPSTGEHELSAGF

• Sequence length: 355

Pathways

KEGG:

Cytokine-cytokine receptor interaction
Viral protein interaction with cytokine and cytokine receptor
Chemokine signaling pathway
Human cytomegalovirus infection
Kaposi sarcoma-associated herpesvirus infection

Reactome:

Chemokine receptors bind chemokines
G alpha (i) signalling events
Interleukin-10 signaling

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Behcet disease	—	Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BEHCET SYNDROME	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLONIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONTACT DERMATITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATITIS, ALLERGIC CONTACT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATITIS, CONTACT	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERSENSITIVITY	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acne	Acne	BEFREE	14759987		★☆☆☆☆ Found in Text Mining only
Acne	Acne	HPO_DG			★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	22789920		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	22801742	Stimulate	★☆☆☆☆ Found in Text Mining only
Androgen Insensitivity Syndrome	Androgen insensitivity syndrome	Pubtator	34867780	Associate	★☆☆☆☆ Found in Text Mining only
Anorexia	Anorexia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic Valve Insufficiency	HPO_DG			★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	16107514, 28619088	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	28619088		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	29880013	Stimulate	★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	11352233, 12909630, 15548526, 31554310	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	14607956, 15548526, 16204626, 18178867, 23258953, 24560857		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	15548526, 18178867	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	LHGDN	18178867		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	32787365, 35287505, 38277520	Associate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	37108638	Stimulate	★☆☆☆☆ Found in Text Mining only
	Behcet Syndrome	Orphanet			★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	22829007, 26097239, 29895319, 31393598		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Behcet Syndrome	Behcet Syndrome	CTD_human_DG	23291587		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Behcet Syndrome	Behcet Syndrome	ORPHANET_DG	26097239		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Behcet Syndrome	Behcet disease	Pubtator	29895319	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar disorder	Pubtator	25487697	Associate	★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	15730850	Stimulate	★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone Disease	BEFREE	21403648		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	16518599, 29685151	Associate	★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	35408790	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	12651617, 26501423, 29285854, 34050704, 38274805, 38552222	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	30409062, 30788000		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	17926037	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	11556842, 17926037		★☆☆☆☆ Found in Text Mining only
Carotid Artery Diseases	Carotid artery disease	Pubtator	34140767	Associate	★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	11465714	Associate	★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	HPO_DG			★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	19693089		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	38277520	Associate	★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	33045415	Associate	★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	11200816		★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	11805137		★☆☆☆☆ Found in Text Mining only
Ciliary Motility Disorders	Ciliary dyskinesia	Pubtator	29116124	Associate	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	31842582	Inhibit	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	37055495	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	25326065		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	22614322, 23891973, 27492974		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	35715847	Associate	★☆☆☆☆ Found in Text Mining only
Contact Dermatitis	Dermatitis	CTD_human_DG	25724174		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	Pubtator	12742282	Associate	★☆☆☆☆ Found in Text Mining only
Cranial nerve palsies	Cranial Nerve Paralysis	HPO_DG			★☆☆☆☆ Found in Text Mining only
CREST Syndrome	CREST Syndrome	BEFREE	21425123		★☆☆☆☆ Found in Text Mining only
Critical Illness	Critical illness	Pubtator	32360286	Stimulate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	29556615		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	29556615	Associate	★☆☆☆☆ Found in Text Mining only
Developmental regression	Developmental regression	HPO_DG			★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	20059422		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	20059422		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	16249462		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	21289263		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	38206700	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	12610055, 16249462		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	16373702		★☆☆☆☆ Found in Text Mining only
ECTRODACTYLY, ECTODERMAL DYSPLASIA, AND CLEFT LIP/PALATE SYNDROME 1	Ectrodactyly	BEFREE	20015385		★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Endocarditis	Endocarditis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	15950672, 17261287, 19050323, 20732991, 28168715		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	LHGDN	15950672		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	15950672, 17261287	Associate	★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	BEFREE	15593301		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	23418513	Associate	★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	17926037		★☆☆☆☆ Found in Text Mining only
Familial Primary Pulmonary Hypertension	Pulmonary hypertension	Pubtator	33478117	Associate	★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	19603542		★☆☆☆☆ Found in Text Mining only
Gangrene	Gangrene	HPO_DG			★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	Pubtator	36973348	Associate	★☆☆☆☆ Found in Text Mining only
GATA2 Deficiency	Gata2 deficiency	Pubtator	37798178	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	22425022		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	22425022		★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis Focal Segmental	Focal segmental glomerulosclerosis	Pubtator	35693262	Associate	★☆☆☆☆ Found in Text Mining only
Glycogen storage disease type II	Glycogen Storage Disease	BEFREE	22789920		★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	15812393	Stimulate	★☆☆☆☆ Found in Text Mining only
Granulomatous Disease Chronic	Granulomatous disease	Pubtator	14688376	Associate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	32967511	Associate	★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	32967511	Associate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	20154287	Associate	★☆☆☆☆ Found in Text Mining only
Hyperlipidemias	Hyperlipidemia	Pubtator	38277520	Associate	★☆☆☆☆ Found in Text Mining only
Hyperplasia	Hyperplasia	Pubtator	32006659	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	38277520	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	10427991	Inhibit	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	11556842	Stimulate	★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	21425123		★☆☆☆☆ Found in Text Mining only
Keratoconjunctivitis Sicca	Keratoconjunctivitis Sicca	HPO_DG			★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	11805137		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	17597825	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Hairy Cell	Hairy cell leukemia	Pubtator	15001469	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Mast Cell	Mast cell leukemia	Pubtator	8188667	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	20154287, 27258612	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	12651617, 17336272, 26501423, 26763650, 29285854, 30070719		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	12651617, 17336272		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	16284949		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	20548789	Associate	★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	20548789	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver neoplasms	Liver neoplasms	BEFREE	12651617		★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	LHGDN	19017998		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	19309748	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	30953795	Stimulate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	28954264	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	27231253, 28954264		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	24367031		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	20154287, 37798178	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	18174380, 35887224	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	18174380		★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	30894217	Associate	★☆☆☆☆ Found in Text Mining only
Majeed syndrome	Majeed syndrome	Pubtator	33314777	Associate	★☆☆☆☆ Found in Text Mining only
Malabsorption Syndrome	Malabsorption Syndrome	HPO_DG			★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	30409062, 30788000		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	11556842		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	23876400		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	19082487, 25326065, 28855206		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	25326065		★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	31983065	Associate	★☆☆☆☆ Found in Text Mining only
Microscopic Polyangiitis	Microscopic polyangiitis	Pubtator	23690996, 28569178	Associate	★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	HPO_DG			★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	33188570, 37001702	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	14998494, 15730850, 21403648, 25962684, 28855206		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	15730850, 17715391, 20154287	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	11086101, 25242631		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	11696431, 12909630, 15548526	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	38277520	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	HPO_DG			★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial ischemia	Pubtator	32967511, 38277520	Associate	★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Narcolepsy	Narcolepsy	BEFREE	25986216		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	23054685		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	36466903	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11556842, 17914560, 18215331, 22425022		★☆☆☆☆ Found in Text Mining only
Nephritis	Nephritis	BEFREE	24367031		★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	17116220		★☆☆☆☆ Found in Text Mining only
Neutrophilia (disorder)	Neutrophilia	BEFREE	30928429		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	18972130, 30720175		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	19837927, 32188105	Associate	★☆☆☆☆ Found in Text Mining only
Oral Ulcer	Oral Ulcer	HPO_DG			★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	31554310	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis Knee	Osteoarthritis	Pubtator	32006659	Associate	★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	22364730		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	36973348	Associate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	11556842		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	11556842, 35750747	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	23699752	Associate	★☆☆☆☆ Found in Text Mining only
Pericarditis	Pericarditis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	BEFREE	20059422		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	24476546		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	38206700	Associate	★☆☆☆☆ Found in Text Mining only
Pleural effusion disorder	Pleural effusion	HPO_DG			★☆☆☆☆ Found in Text Mining only
Pleurisy	Pleuritis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	23876400		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	16969502		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	36806315	Associate	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	11310827		★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	20808962	Stimulate	★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	21425123	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	33260035	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary fibrosis	Pubtator	19729668	Stimulate	★☆☆☆☆ Found in Text Mining only
Recurrent aphthous ulcer	Aphthous Ulcer	HPO_DG			★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	11805137		★☆☆☆☆ Found in Text Mining only
Renal glomerular disease	Renal Glomerular Disease	HPO_DG			★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	HPO_DG			★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	HPO_DG			★☆☆☆☆ Found in Text Mining only
Retrobulbar Neuritis	Retrobulbar Neuritis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	15548526, 29766547		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	19017998		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	25487697	Associate	★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	35222683	Associate	★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	28954264	Associate	★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	28954264		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	17914560		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	17914560		★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	38277520	Associate	★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	26928433		★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	38277520	Associate	★☆☆☆☆ Found in Text Mining only
Trigeminal Neuralgia	Trigeminal neuralgia	Pubtator	34067581	Stimulate	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	31842582		★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	HPO_DG			★☆☆☆☆ Found in Text Mining only